SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 368979 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  368979
Domain Number - Region: 131-225
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0387
Family Galacturonase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 368979
Sequence length 275
Comment $ JCSG $ SQ116914 $ PDBT29148 $
Sequence
MRKSLKMTIGIGLILSCFGLILVGIGLSSGGIDKLQVKDDQAPKKEVQFDNIQSLDLDLS
VRNIKIESSQDQHFKLTYYKKLDEEISHKVQHQKLNLKQKEKFRIHFFVLSDFFNWFHQD
DTNTVTLAIPKNVQLKDVSIKNNVGDITIKNQQASKITVHQNTGNLNIYNSQIAKGKVSS
DVGNIAIQNSSLSNIDVVDHTGDISAENLTVLNLVRMTNNIGNTNVSLSPQSAQATIVST
KTDVGHTDISHQLLQGYSGKNRLAVKGDTGNIQIK
Download sequence
Identical sequences Q8DSR5
210007.SMU.1706 368979 SmR85 NP_722035.1.8892 WP_002279626.1.15378 WP_002279626.1.15966 WP_002279626.1.3499 WP_002279626.1.38244 WP_002279626.1.71645 WP_002279626.1.72550 WP_002279626.1.78804 WP_002279626.1.94193 gi|24380080|ref|NP_722035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]