SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 368980 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  368980
Domain Number 1 Region: 155-263
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 368980
Sequence length 274
Comment $ JCSG $ SQ116915 $ PDBT29149 $
Sequence
MSIMNSLLQQKETVVKGWLTYYVSVDDPYVFALKDDHRLMDETGFVLENLFIGMTEDLAK
MNTFARELGKAQFITSLGISRILFHIRLLEEFLLDYASEINAECNNYRELYLFSIKLHQV
FSSFTQHLIEGYTLATEQLVQQKENQIIKSSTKLIWLAEKVFLLPLIGKITDERAKQITE
TALFETCEQPVNYLIIDLSGVQFDSANIGEYIEHFFSSLKLVGVTPIITGMQPETAKIMV
QANLTEQKGIKTFATLRQATKSLIKEKEARNAIK
Download sequence
Identical sequences H1G8I8 Q92AG6
368980 gi|16801022|ref|NP_471290.1| WP_003762975.1.46653 WP_003762975.1.51650 WP_003762975.1.99521 272626.lin1956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]