SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372178 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372178
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.71e-28
Family Sfri0576-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 372178
Sequence length 122
Comment $ JCSG $ SQ118251 $ PDBT30992 $
Sequence
MITQIQNLPANMVGFKATNEVTQEDFTNKVIPTVKELVEKTDTLNYMLVLDTSVKDFTAG
AWFKDAVLGVKNLTKWNRAAIVSDEKGVKTFTDVFSVLVPGEFKVFEHKDQQKAIDWVSG
LN
Download sequence
Identical sequences Q11VP6
gi|110637653|ref|YP_677860.1| 372178 269798.CHU_1248 WP_011584635.1.19587 WP_011584635.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]