SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372335 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372335
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-38
Family Sfri0576-like 0.00029
Further Details:      
 
Domain Number 2 Region: 132-279
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.1e-24
Family Universal stress protein-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 372335
Sequence length 285
Comment $ JCSG $ SQ118331 $ PDBT31075 $
Sequence
MLQFIPVFDGNTIAVRASGKLTLEDFQQFFPQLETQIKRLGKISLLFEFDNFSGWDLDAA
IDDIKFGMKHLSDFERIAMVGDKSWEHWMALIAKPFLISSEVRYFNRENLQQAWDWLREK
QEFEKAVEQLQPYQNIVVAVDFSLYSKHACKRAIELANYYQASLTLLNVVPEVLAYTLYG
DPVGYNVVDLDIIKDQNKKNIDAAQFQMKAFVNDLDTNFPIETKVICGEINYGVVSFLEA
QHIDLAIFGAKKKKGINKLLGSVPHYVQNHSRCEILIVPVQGPVF
Download sequence
Identical sequences Q083D4
372335 318167.Sfri_1781 gi|114562956|ref|YP_750469.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]