SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372337 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372337
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.45e-38
Family Sfri0576-like 0.000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 372337
Sequence length 125
Comment $ JCSG $ SQ118332 $ PDBT31076 $
Sequence
MSSNLHGIAIGIERSQDDFYLAFKAVGKLTHEDYEQMTPLLESALAGIKTPEIVALIDIT
ELDGLSLHAAWDDLKLGLKHGKEFKRVAIIGQGELQEWATRVANWFTPGEFKFFEDKRDA
LDWLC
Download sequence
Identical sequences A3QHM0
d2q3la1 d2q3lb2 WP_011866898.1.33760 323850.Shew_3102 372337 gi|127514030|ref|YP_001095227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]