SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372358 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372358
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000051
Family Sfri0576-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 372358
Sequence length 125
Comment $ JCSG $ SQ118345 $ PDBT31089 $
Sequence
MSKLNVSTTVSGDIIVTRLIGKIKTDDVYEWFNGFEQVCQQFISEGRKYKLLVDRKGYIP
DHFSVQKVWKEKFFNETILNHSKAIAFLLEEGEIMNYLQQSNTKESVKFFDDYRQAFLWL
NEYPI
Download sequence
Identical sequences A0A150ECJ8 A0A1J9Y094 Q734J0
gi|42782468|ref|NP_979715.1| 222523.BCE_3415 WP_000040820.1.24759 WP_000040820.1.39001 WP_000040820.1.45089 WP_000040820.1.49802 WP_000040820.1.50770 WP_000040820.1.51656 WP_000040820.1.59052 WP_000040820.1.61944 WP_000040820.1.65758 WP_000040820.1.79043 WP_000040820.1.92347 WP_000040820.1.97617 372358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]