SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372476 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372476
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.18e-38
Family Sfri0576-like 0.000000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 372476
Sequence length 126
Comment $ JCSG $ SQ118409 $ PDBT31154 $
Sequence
MDMKKHGLSIGINRIESVFFVTLKAIGTLTHEDYLVITPMLEGALSQVDQPKVSLFLDAT
ELDGWDLRAAWDDLKLGLKHKSEFERVAILGNKDWQEWAAKIGSWFIAGEIKYFEDEDDA
LKWLRY
Download sequence
Identical sequences A0A2I0H6G5 Q087X8
WP_011636064.1.15765 318167.Sfri_0576 372476 gi|114561762|ref|YP_749275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]