SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372505 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372505
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.18e-35
Family Sfri0576-like 0.00000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 372505
Sequence length 127
Comment $ JCSG $ SQ118423 $ PDBT31168 $
Sequence
MTLLKHGISIGIERYGDDDFFVAFKAIGTLTHQDYERMVPVLESALAGVKDPDIFALVDV
TELDGLELQAAWDDIKLGVKHIRHFEKIAIVGKTTLQEVLAKLANWFTPAEVRFFVDNGD
AVAWLRD
Download sequence
Identical sequences A4Y9R3 E6XKR4
WP_011788342.1.65999 WP_011788342.1.82224 WP_011788342.1.85280 WP_011788342.1.98421 gi|120597796|ref|YP_962370.1| gi|146294071|ref|YP_001184495.1| 372505 319224.Sputcn32_2981 351745.Sputw3181_0966 gi|386314786|ref|YP_006010951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]