SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372708 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372708
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.79e-31
Family Sfri0576-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 372708
Sequence length 114
Comment $ JCSG $ SQ118528 $ PDBT31275 $
Sequence
MITIEETENLISIAVFGEFTLADYQEFEDKVLRKAGREGKVNVLFDWRDMLSYTIDVAWE
DIKFVREHGSEFNRIAIITENQWRAWAAWVSNLFVDADIRVFRDYAAAKTWLEG
Download sequence
Identical sequences A0A1H3VU68 Q2YCI1
323848.Nmul_A0232 WP_011379594.1.10075 WP_011379594.1.92891 372708 gi|82701366|ref|YP_410932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]