SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372825 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372825
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-24
Family Sfri0576-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 372825
Sequence length 135
Comment $ JCSG $ SQ118589 $ PDBT31336 $
Sequence
MSTQIYETIEQIPTTAPNVYAFRVTGHIDDDASEALAKFMLAAFDRHEEKVDMLLDLTAF
TGSDWDSMLDGDVIKSRFRSLSEVRRYAVIGAPDRAAKMIEFMDKIIPVEAKAFDANQKD
AAWAFVGASEASVSV
Download sequence
Identical sequences Q28QM9
372825 WP_011455187.1.50977 gi|89054557|ref|YP_510008.1| 290400.Jann_2066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]