SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 372861 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  372861
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.28e-19
Family Sfri0576-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 372861
Sequence length 127
Comment $ JCSG $ SQ118609 $ PDBT31357 $
Sequence
MLCQIADITNGVISLFASGRLSTQDYCNKIVPIIEEYQQASGKVCLYIEADVLLEGWESQ
SLSGVGELQLPRFDALVLVGGPDWFGNAVRLMGPFMQGEVAWYALEDKPQAIEWITAKLS
CPLVRES
Download sequence
Identical sequences A3QIC9
gi|127514289|ref|YP_001095486.1| 372861 323850.Shew_3361 WP_011867157.1.33760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]