SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376035 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376035
Domain Number 1 Region: 21-129
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.66e-25
Family Flavin-binding PAS domain 0.00077
Further Details:      
 
Domain Number 2 Region: 148-258
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 376035
Sequence length 261
Comment $ JCSG $ SQ128083 $ PDBT33473 $
Sequence
MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGK
NCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFV
GIQNDITKQKEYEKLLEDSLTEITALSTPIVPIRNGISALPLVGNLTEERFNSIVCTLTN
ILSTSKDDYLIIDLSGLAQVNEQTADQIFKLSHLLKLTGTELIITGIKPELAMKMNKLDA
NFSSLKTYSNVKDAVKVLPIM
Download sequence
Identical sequences A0A164WQ81 A0A1B2B6A5 L8AQQ1 O34627
NP_390912.1.22788 WP_004399022.1.11257 WP_004399022.1.1140 WP_004399022.1.12644 WP_004399022.1.12759 WP_004399022.1.1358 WP_004399022.1.15902 WP_004399022.1.16291 WP_004399022.1.23108 WP_004399022.1.2546 WP_004399022.1.27660 WP_004399022.1.2914 WP_004399022.1.31028 WP_004399022.1.32025 WP_004399022.1.32219 WP_004399022.1.32420 WP_004399022.1.32693 WP_004399022.1.33846 WP_004399022.1.36189 WP_004399022.1.39605 WP_004399022.1.40859 WP_004399022.1.44184 WP_004399022.1.45019 WP_004399022.1.47157 WP_004399022.1.56274 WP_004399022.1.56411 WP_004399022.1.57156 WP_004399022.1.57201 WP_004399022.1.5726 WP_004399022.1.57513 WP_004399022.1.6139 WP_004399022.1.64889 WP_004399022.1.6517 WP_004399022.1.65223 WP_004399022.1.72999 WP_004399022.1.76977 WP_004399022.1.78686 WP_004399022.1.81116 WP_004399022.1.81747 WP_004399022.1.82722 WP_004399022.1.84183 WP_004399022.1.87300 WP_004399022.1.88042 WP_004399022.1.89821 WP_004399022.1.90830 WP_004399022.1.91723 WP_004399022.1.93420 WP_004399022.1.94199 WP_004399022.1.96043 WP_004399022.1.979 gi|470163246|ref|YP_007535021.1| gi|560130019|ref|YP_008831160.1| 224308.BSU30340 376035 GO.3268 gi|402777188|ref|YP_006631132.1| gi|16080086|ref|NP_390912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]