SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376066 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376066
Domain Number 1 Region: 141-243
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.41e-26
Family Anti-sigma factor antagonist SpoIIaa 0.0011
Further Details:      
 
Domain Number 2 Region: 22-131
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000162
Family Histidine kinase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 376066
Sequence length 249
Comment $ JCSG $ SQ127628 $ PDBT33490 $
Sequence
MESITLTADLDALAKTSAFITAAAERCGLDERATWQVQLAVDEAVTNVIQHAYDPDQPGD
FTLSWQCHDQRFIVTVRDHGRQFDPSTVPVPDITSPLEERQVGGLGIYLITRLMDEVHFE
FSPQGGNLLTMVKYLPSDQAEEANEVVVIPINDRIDALTAPRLSKTVNEQISQGARQIVL
DFSNVPFLSSSGLRALLLIRKELMTLGGELRLAALQPQVHEVFTITGFTQVFNIHPSVTE
ARAAFSQRR
Download sequence
Identical sequences A9WIJ2
324602.Caur_1060 480224.Chy400_1158 WP_012256948.1.35445 YP_001634681.1.55443 gi|163846637|ref|YP_001634681.1| 376066 gi|222524434|ref|YP_002568905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]