SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376426 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376426
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-26
Family Anti-sigma factor antagonist SpoIIaa 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 376426
Sequence length 110
Comment $ JCSG $ SQ128231 $ PDBT33765 $
Sequence
MTLTTITHDNVTILEMRERLDGQGTQQLEKTVEELLSAGARTLLFDFQDLDYINSSGLRV
LVMAYQRLHPAGGTVTICCARDYIQEVFEISGYDKLFGMYETRDAALGSL
Download sequence
Identical sequences Q314X5
WP_011366802.1.27936 WP_011366802.1.39573 376426 207559.Dde_0720 gi|78355767|ref|YP_387216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]