SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376443 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376443
Domain Number 1 Region: 11-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.46e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 376443
Sequence length 131
Comment $ JCSG $ SQ128627 $ PDBT33779 $
Sequence
VSGHTQESFPCGEAVVFTVRGEIDIANATQLCAALLHATDRSECQCLIVDLSKVQFIDLS
GVRALYECCRVLTWEGRHMVLAEPSAAAQRVLTALRMDRDFEIYPIVEAALVHTARQRYE
EGPITGVCGCD
Download sequence
Identical sequences 376443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]