SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376445 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376445
Domain Number 1 Region: 13-95
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000108
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 376445
Sequence length 96
Comment $ JCSG $ SQ128238 $ PDBT33781 $
Sequence
MANALNWQVQESTLALTGDLDRETLLPFWQQRESLLAGKTTLDVSGLNRVDSAGLALLMH
VYQQPSSGGEIAIVGASDRLKTLIALYNLNEIIPVS
Download sequence
Identical sequences Q6DAF4
376445 WP_011091932.1.17763 WP_011091932.1.32123 WP_011091932.1.57850 WP_011091932.1.77917 WP_011091932.1.79946 WP_011091932.1.80346 WP_011091932.1.94180 gi|50119259|ref|YP_048426.1| 218491.ECA0299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]