SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376455 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376455
Domain Number 1 Region: 6-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 376455
Sequence length 122
Comment $ JCSG $ SQ128244 $ PDBT33790 $
Sequence
MLEDELTVNIRQRDGVAVIDLIGDVTTFAEEKINNAYRQVTARGERFILFNFRQNDYINS
AGIAILIGIVTEVNQNGQRLAVSGLSPHFQKIFRMVGLAQYAEIYQTEDEAISAFRRLNT
LE
Download sequence
Identical sequences A9WGN4
324602.Caur_2357 480224.Chy400_2544 WP_012258220.1.35445 YP_001635955.1.55443 376455 gi|222525791|ref|YP_002570262.1| gi|163847911|ref|YP_001635955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]