SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376470 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376470
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 376470
Sequence length 111
Comment $ JCSG $ SQ128631 $ PDBT33800 $
Sequence
MGQDEIGDLGIIHLDGAQTLRTADETYSKLREEGGRYAVLEIDCLGVTEVDLSFIQMLIA
ARTRARSMGRTLRLAHPASGALLEALERGGFLTGIPDQATDQAFWLQPEKA
Download sequence
Identical sequences Q2RUJ7
gi|83592733|ref|YP_426485.1| 376470 269796.Rru_A1397 gi|386349462|ref|YP_006047710.1| WP_011389151.1.3410 YP_426485.1.57063 2005477553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]