SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376482 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376482
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.71e-16
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 376482
Sequence length 100
Comment $ JCSG $ SQ128254 $ PDBT33810 $
Sequence
MQYSIKTSGNGAELTIKGRLTFTEAATFPKILAEMDKIGQSHWAIRLDDLTTIDSTGMSL
FVHVYDGANAAGTKVVIHGAKGVVREALNRAAFQTLFEIR
Download sequence
Identical sequences A0A0C2U6I8
WP_009870735.1.91102 376482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]