SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376483 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376483
Domain Number 1 Region: 10-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.08e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 376483
Sequence length 101
Comment $ JCSG $ SQ128255 $ PDBT33811 $
Sequence
MAITALPSADGQELTIQIQGRFDFGAHQDFRDAYERVAITPRRYVVDLRNATYLDSSALG
MLLLLRDHAGGENAQISLANCSPEVRKILAISNFEQLFKIS
Download sequence
Identical sequences A0A071LBP3 A0A0E1AV60 A0A0H3RCI0 A0A157WCL9 A0A1C7BKG1 A0A1E9CVV1 A0A1F0II97 A0A1G5F055 A0A1S1C8I3 Q02QI1 Q9HYP8 W1MHE2
gi|514410573|ref|YP_008133985.1| gi|558667125|ref|YP_008803835.1| gi|392982915|ref|YP_006481502.1| 376483 208963.PA14_20770 208964.PA3347 557722.PLES_17171 gi|116051362|ref|YP_789805.1| NP_252037.1.87394 WP_003091727.1.100071 WP_003091727.1.100100 WP_003091727.1.100179 WP_003091727.1.100276 WP_003091727.1.100278 WP_003091727.1.100319 WP_003091727.1.100394 WP_003091727.1.100420 WP_003091727.1.100456 WP_003091727.1.100469 WP_003091727.1.100473 WP_003091727.1.100476 WP_003091727.1.100523 WP_003091727.1.100654 WP_003091727.1.100723 WP_003091727.1.100742 WP_003091727.1.100777 WP_003091727.1.100786 WP_003091727.1.100808 WP_003091727.1.100809 WP_003091727.1.100810 WP_003091727.1.100872 WP_003091727.1.100983 WP_003091727.1.100995 WP_003091727.1.101021 WP_003091727.1.101047 WP_003091727.1.101090 WP_003091727.1.101269 WP_003091727.1.101310 WP_003091727.1.101340 WP_003091727.1.101506 WP_003091727.1.101572 WP_003091727.1.101590 WP_003091727.1.101642 WP_003091727.1.101712 WP_003091727.1.101739 WP_003091727.1.10174 WP_003091727.1.101781 WP_003091727.1.10179 WP_003091727.1.101809 WP_003091727.1.101819 WP_003091727.1.10185 WP_003091727.1.101863 WP_003091727.1.101871 WP_003091727.1.10201 WP_003091727.1.10202 WP_003091727.1.10204 WP_003091727.1.102045 WP_003091727.1.10228 WP_003091727.1.10248 WP_003091727.1.10257 WP_003091727.1.10271 WP_003091727.1.1037 WP_003091727.1.10407 WP_003091727.1.10419 WP_003091727.1.10435 WP_003091727.1.10457 WP_003091727.1.10468 WP_003091727.1.10477 WP_003091727.1.10482 WP_003091727.1.10513 WP_003091727.1.10529 WP_003091727.1.10548 WP_003091727.1.10572 WP_003091727.1.10575 WP_003091727.1.10636 WP_003091727.1.10641 WP_003091727.1.10684 WP_003091727.1.10764 WP_003091727.1.10856 WP_003091727.1.10895 WP_003091727.1.10901 WP_003091727.1.10949 WP_003091727.1.11026 WP_003091727.1.11058 WP_003091727.1.1107 WP_003091727.1.11077 WP_003091727.1.1109 WP_003091727.1.11130 WP_003091727.1.11163 WP_003091727.1.11178 WP_003091727.1.11180 WP_003091727.1.11318 WP_003091727.1.11381 WP_003091727.1.11388 WP_003091727.1.11410 WP_003091727.1.11417 WP_003091727.1.11454 WP_003091727.1.11568 WP_003091727.1.11569 WP_003091727.1.11653 WP_003091727.1.11744 WP_003091727.1.11754 WP_003091727.1.1180 WP_003091727.1.1183 WP_003091727.1.11847 WP_003091727.1.11854 WP_003091727.1.1187 WP_003091727.1.11943 WP_003091727.1.12018 WP_003091727.1.12081 WP_003091727.1.12120 WP_003091727.1.12150 WP_003091727.1.12200 WP_003091727.1.12208 WP_003091727.1.12240 WP_003091727.1.12302 WP_003091727.1.12354 WP_003091727.1.1238 WP_003091727.1.12400 WP_003091727.1.12482 WP_003091727.1.12530 WP_003091727.1.12547 WP_003091727.1.12561 WP_003091727.1.12657 WP_003091727.1.12660 WP_003091727.1.12670 WP_003091727.1.12687 WP_003091727.1.12744 WP_003091727.1.12797 WP_003091727.1.12838 WP_003091727.1.12873 WP_003091727.1.12890 WP_003091727.1.12891 WP_003091727.1.12922 WP_003091727.1.12930 WP_003091727.1.12934 WP_003091727.1.12970 WP_003091727.1.12980 WP_003091727.1.13 WP_003091727.1.13041 WP_003091727.1.1305 WP_003091727.1.13057 WP_003091727.1.13077 WP_003091727.1.13085 WP_003091727.1.13092 WP_003091727.1.13208 WP_003091727.1.13232 WP_003091727.1.13242 WP_003091727.1.13266 WP_003091727.1.13315 WP_003091727.1.1333 WP_003091727.1.13364 WP_003091727.1.13407 WP_003091727.1.13529 WP_003091727.1.13533 WP_003091727.1.1356 WP_003091727.1.1362 WP_003091727.1.13622 WP_003091727.1.13642 WP_003091727.1.13718 WP_003091727.1.13743 WP_003091727.1.13758 WP_003091727.1.13765 WP_003091727.1.13785 WP_003091727.1.13795 WP_003091727.1.13828 WP_003091727.1.13865 WP_003091727.1.1393 WP_003091727.1.14049 WP_003091727.1.14078 WP_003091727.1.14096 WP_003091727.1.14116 WP_003091727.1.14204 WP_003091727.1.14251 WP_003091727.1.14378 WP_003091727.1.14424 WP_003091727.1.14455 WP_003091727.1.14460 WP_003091727.1.14463 WP_003091727.1.14476 WP_003091727.1.14525 WP_003091727.1.14564 WP_003091727.1.14615 WP_003091727.1.14640 WP_003091727.1.14679 WP_003091727.1.14690 WP_003091727.1.14714 WP_003091727.1.1475 WP_003091727.1.14754 WP_003091727.1.14797 WP_003091727.1.14815 WP_003091727.1.14820 WP_003091727.1.14835 WP_003091727.1.14839 WP_003091727.1.14883 WP_003091727.1.14966 WP_003091727.1.14981 WP_003091727.1.15004 WP_003091727.1.15130 WP_003091727.1.1516 WP_003091727.1.152 WP_003091727.1.15222 WP_003091727.1.15231 WP_003091727.1.15281 WP_003091727.1.15297 WP_003091727.1.15328 WP_003091727.1.15373 WP_003091727.1.15379 WP_003091727.1.15408 WP_003091727.1.15474 WP_003091727.1.15480 WP_003091727.1.15482 WP_003091727.1.15485 WP_003091727.1.15602 WP_003091727.1.15606 WP_003091727.1.15666 WP_003091727.1.15692 WP_003091727.1.15886 WP_003091727.1.15889 WP_003091727.1.15934 WP_003091727.1.16041 WP_003091727.1.16074 WP_003091727.1.16109 WP_003091727.1.16142 WP_003091727.1.16161 WP_003091727.1.16197 WP_003091727.1.162 WP_003091727.1.16239 WP_003091727.1.16242 WP_003091727.1.16267 WP_003091727.1.16279 WP_003091727.1.16419 WP_003091727.1.1646 WP_003091727.1.16660 WP_003091727.1.16694 WP_003091727.1.1670 WP_003091727.1.1671 WP_003091727.1.16751 WP_003091727.1.16782 WP_003091727.1.16788 WP_003091727.1.16801 WP_003091727.1.16808 WP_003091727.1.16811 WP_003091727.1.16895 WP_003091727.1.17022 WP_003091727.1.1704 WP_003091727.1.17108 WP_003091727.1.17155 WP_003091727.1.17162 WP_003091727.1.17177 WP_003091727.1.17189 WP_003091727.1.172 WP_003091727.1.17223 WP_003091727.1.17353 WP_003091727.1.17354 WP_003091727.1.17370 WP_003091727.1.1739 WP_003091727.1.17397 WP_003091727.1.17499 WP_003091727.1.17566 WP_003091727.1.1758 WP_003091727.1.1761 WP_003091727.1.17697 WP_003091727.1.17883 WP_003091727.1.17890 WP_003091727.1.18052 WP_003091727.1.18054 WP_003091727.1.18117 WP_003091727.1.18156 WP_003091727.1.18157 WP_003091727.1.18199 WP_003091727.1.18204 WP_003091727.1.18234 WP_003091727.1.1824 WP_003091727.1.18349 WP_003091727.1.18440 WP_003091727.1.18493 WP_003091727.1.18508 WP_003091727.1.18653 WP_003091727.1.18728 WP_003091727.1.18732 WP_003091727.1.18735 WP_003091727.1.18769 WP_003091727.1.18795 WP_003091727.1.18852 WP_003091727.1.18892 WP_003091727.1.18907 WP_003091727.1.18911 WP_003091727.1.18930 WP_003091727.1.190 WP_003091727.1.19089 WP_003091727.1.19199 WP_003091727.1.19251 WP_003091727.1.19260 WP_003091727.1.19269 WP_003091727.1.19346 WP_003091727.1.19351 WP_003091727.1.19376 WP_003091727.1.1938 WP_003091727.1.19552 WP_003091727.1.19640 WP_003091727.1.19703 WP_003091727.1.1971 WP_003091727.1.19711 WP_003091727.1.19718 WP_003091727.1.19741 WP_003091727.1.19771 WP_003091727.1.19803 WP_003091727.1.19824 WP_003091727.1.19930 WP_003091727.1.19931 WP_003091727.1.20024 WP_003091727.1.20070 WP_003091727.1.2012 WP_003091727.1.20125 WP_003091727.1.20134 WP_003091727.1.20154 WP_003091727.1.20216 WP_003091727.1.20342 WP_003091727.1.20590 WP_003091727.1.20682 WP_003091727.1.20692 WP_003091727.1.20744 WP_003091727.1.20764 WP_003091727.1.20825 WP_003091727.1.20854 WP_003091727.1.20880 WP_003091727.1.20884 WP_003091727.1.20890 WP_003091727.1.209 WP_003091727.1.20929 WP_003091727.1.20978 WP_003091727.1.21002 WP_003091727.1.21039 WP_003091727.1.21096 WP_003091727.1.21100 WP_003091727.1.21166 WP_003091727.1.21209 WP_003091727.1.21242 WP_003091727.1.21302 WP_003091727.1.21349 WP_003091727.1.21358 WP_003091727.1.2144 WP_003091727.1.21448 WP_003091727.1.21460 WP_003091727.1.21469 WP_003091727.1.21471 WP_003091727.1.21517 WP_003091727.1.21607 WP_003091727.1.21718 WP_003091727.1.2172 WP_003091727.1.21744 WP_003091727.1.21767 WP_003091727.1.21782 WP_003091727.1.21801 WP_003091727.1.21871 WP_003091727.1.21891 WP_003091727.1.21932 WP_003091727.1.22078 WP_003091727.1.221 WP_003091727.1.2228 WP_003091727.1.22316 WP_003091727.1.22324 WP_003091727.1.22365 WP_003091727.1.2237 WP_003091727.1.22389 WP_003091727.1.22390 WP_003091727.1.22394 WP_003091727.1.22442 WP_003091727.1.22477 WP_003091727.1.22491 WP_003091727.1.22573 WP_003091727.1.22671 WP_003091727.1.22704 WP_003091727.1.22729 WP_003091727.1.22863 WP_003091727.1.2289 WP_003091727.1.22891 WP_003091727.1.23013 WP_003091727.1.23166 WP_003091727.1.23191 WP_003091727.1.23195 WP_003091727.1.2323 WP_003091727.1.23264 WP_003091727.1.23331 WP_003091727.1.23418 WP_003091727.1.23421 WP_003091727.1.23512 WP_003091727.1.23518 WP_003091727.1.23523 WP_003091727.1.23525 WP_003091727.1.2355 WP_003091727.1.23559 WP_003091727.1.23581 WP_003091727.1.236 WP_003091727.1.23611 WP_003091727.1.23641 WP_003091727.1.23715 WP_003091727.1.23739 WP_003091727.1.2374 WP_003091727.1.23769 WP_003091727.1.23782 WP_003091727.1.23794 WP_003091727.1.23884 WP_003091727.1.23925 WP_003091727.1.23938 WP_003091727.1.23961 WP_003091727.1.23967 WP_003091727.1.23983 WP_003091727.1.24066 WP_003091727.1.24077 WP_003091727.1.24087 WP_003091727.1.24101 WP_003091727.1.24183 WP_003091727.1.24234 WP_003091727.1.24319 WP_003091727.1.24351 WP_003091727.1.24382 WP_003091727.1.24413 WP_003091727.1.24447 WP_003091727.1.2453 WP_003091727.1.24626 WP_003091727.1.24662 WP_003091727.1.2477 WP_003091727.1.24851 WP_003091727.1.24862 WP_003091727.1.24869 WP_003091727.1.24879 WP_003091727.1.24938 WP_003091727.1.24940 WP_003091727.1.25033 WP_003091727.1.25052 WP_003091727.1.25067 WP_003091727.1.25075 WP_003091727.1.251 WP_003091727.1.25109 WP_003091727.1.2511 WP_003091727.1.25142 WP_003091727.1.25149 WP_003091727.1.25179 WP_003091727.1.25191 WP_003091727.1.25271 WP_003091727.1.2529 WP_003091727.1.2530 WP_003091727.1.25328 WP_003091727.1.25344 WP_003091727.1.25348 WP_003091727.1.2535 WP_003091727.1.25477 WP_003091727.1.25532 WP_003091727.1.25600 WP_003091727.1.25641 WP_003091727.1.25675 WP_003091727.1.25695 WP_003091727.1.2572 WP_003091727.1.25834 WP_003091727.1.25903 WP_003091727.1.2596 WP_003091727.1.25964 WP_003091727.1.26010 WP_003091727.1.26025 WP_003091727.1.26042 WP_003091727.1.261 WP_003091727.1.26159 WP_003091727.1.26301 WP_003091727.1.26334 WP_003091727.1.26428 WP_003091727.1.26463 WP_003091727.1.26473 WP_003091727.1.26489 WP_003091727.1.2652 WP_003091727.1.26539 WP_003091727.1.26553 WP_003091727.1.26592 WP_003091727.1.26604 WP_003091727.1.26681 WP_003091727.1.26682 WP_003091727.1.26705 WP_003091727.1.26740 WP_003091727.1.26816 WP_003091727.1.26841 WP_003091727.1.26862 WP_003091727.1.26906 WP_003091727.1.26967 WP_003091727.1.2698 WP_003091727.1.27018 WP_003091727.1.27028 WP_003091727.1.27039 WP_003091727.1.27073 WP_003091727.1.27107 WP_003091727.1.27211 WP_003091727.1.27218 WP_003091727.1.27259 WP_003091727.1.27288 WP_003091727.1.27505 WP_003091727.1.27534 WP_003091727.1.27549 WP_003091727.1.27575 WP_003091727.1.27587 WP_003091727.1.27687 WP_003091727.1.27738 WP_003091727.1.27772 WP_003091727.1.27783 WP_003091727.1.27825 WP_003091727.1.27837 WP_003091727.1.27858 WP_003091727.1.27933 WP_003091727.1.27939 WP_003091727.1.27966 WP_003091727.1.28006 WP_003091727.1.28057 WP_003091727.1.28064 WP_003091727.1.28078 WP_003091727.1.28136 WP_003091727.1.28175 WP_003091727.1.28258 WP_003091727.1.283 WP_003091727.1.28316 WP_003091727.1.28329 WP_003091727.1.28372 WP_003091727.1.28383 WP_003091727.1.28404 WP_003091727.1.28468 WP_003091727.1.28505 WP_003091727.1.28528 WP_003091727.1.28560 WP_003091727.1.28602 WP_003091727.1.28623 WP_003091727.1.28699 WP_003091727.1.28713 WP_003091727.1.28757 WP_003091727.1.28800 WP_003091727.1.28823 WP_003091727.1.28838 WP_003091727.1.28849 WP_003091727.1.28878 WP_003091727.1.28920 WP_003091727.1.29003 WP_003091727.1.29008 WP_003091727.1.29062 WP_003091727.1.29070 WP_003091727.1.29096 WP_003091727.1.29127 WP_003091727.1.29137 WP_003091727.1.29158 WP_003091727.1.29179 WP_003091727.1.29208 WP_003091727.1.2927 WP_003091727.1.29401 WP_003091727.1.2941 WP_003091727.1.29438 WP_003091727.1.29440 WP_003091727.1.29472 WP_003091727.1.2948 WP_003091727.1.29481 WP_003091727.1.29498 WP_003091727.1.29501 WP_003091727.1.29577 WP_003091727.1.2961 WP_003091727.1.29633 WP_003091727.1.29650 WP_003091727.1.29668 WP_003091727.1.29753 WP_003091727.1.29767 WP_003091727.1.2980 WP_003091727.1.29848 WP_003091727.1.29920 WP_003091727.1.29958 WP_003091727.1.29973 WP_003091727.1.30000 WP_003091727.1.30020 WP_003091727.1.30081 WP_003091727.1.30120 WP_003091727.1.30254 WP_003091727.1.3030 WP_003091727.1.30365 WP_003091727.1.30474 WP_003091727.1.30475 WP_003091727.1.30563 WP_003091727.1.30567 WP_003091727.1.30614 WP_003091727.1.30615 WP_003091727.1.30625 WP_003091727.1.30693 WP_003091727.1.30707 WP_003091727.1.3072 WP_003091727.1.30740 WP_003091727.1.30797 WP_003091727.1.30815 WP_003091727.1.30842 WP_003091727.1.30886 WP_003091727.1.30943 WP_003091727.1.30973 WP_003091727.1.30994 WP_003091727.1.31045 WP_003091727.1.31076 WP_003091727.1.31087 WP_003091727.1.31103 WP_003091727.1.31105 WP_003091727.1.31138 WP_003091727.1.31147 WP_003091727.1.31279 WP_003091727.1.31361 WP_003091727.1.31457 WP_003091727.1.31501 WP_003091727.1.31563 WP_003091727.1.31565 WP_003091727.1.31587 WP_003091727.1.31633 WP_003091727.1.31655 WP_003091727.1.3172 WP_003091727.1.31732 WP_003091727.1.31741 WP_003091727.1.31751 WP_003091727.1.3179 WP_003091727.1.31848 WP_003091727.1.31852 WP_003091727.1.3189 WP_003091727.1.319 WP_003091727.1.31939 WP_003091727.1.32134 WP_003091727.1.32137 WP_003091727.1.32144 WP_003091727.1.32235 WP_003091727.1.32289 WP_003091727.1.32314 WP_003091727.1.32359 WP_003091727.1.32523 WP_003091727.1.32544 WP_003091727.1.32596 WP_003091727.1.32626 WP_003091727.1.32637 WP_003091727.1.32641 WP_003091727.1.32711 WP_003091727.1.32821 WP_003091727.1.32869 WP_003091727.1.32879 WP_003091727.1.32998 WP_003091727.1.33009 WP_003091727.1.33047 WP_003091727.1.33097 WP_003091727.1.33133 WP_003091727.1.33152 WP_003091727.1.33186 WP_003091727.1.33204 WP_003091727.1.33210 WP_003091727.1.33216 WP_003091727.1.33294 WP_003091727.1.33340 WP_003091727.1.33387 WP_003091727.1.33438 WP_003091727.1.33441 WP_003091727.1.3351 WP_003091727.1.33517 WP_003091727.1.33521 WP_003091727.1.33523 WP_003091727.1.33547 WP_003091727.1.33549 WP_003091727.1.33658 WP_003091727.1.33669 WP_003091727.1.3368 WP_003091727.1.33728 WP_003091727.1.33733 WP_003091727.1.33734 WP_003091727.1.3376 WP_003091727.1.33774 WP_003091727.1.33801 WP_003091727.1.33814 WP_003091727.1.33822 WP_003091727.1.33824 WP_003091727.1.33833 WP_003091727.1.3385 WP_003091727.1.33945 WP_003091727.1.34000 WP_003091727.1.34039 WP_003091727.1.34136 WP_003091727.1.34143 WP_003091727.1.34150 WP_003091727.1.34151 WP_003091727.1.34180 WP_003091727.1.34191 WP_003091727.1.34203 WP_003091727.1.34306 WP_003091727.1.34317 WP_003091727.1.34324 WP_003091727.1.3436 WP_003091727.1.34401 WP_003091727.1.34402 WP_003091727.1.34465 WP_003091727.1.34472 WP_003091727.1.3452 WP_003091727.1.34556 WP_003091727.1.34568 WP_003091727.1.34583 WP_003091727.1.34625 WP_003091727.1.34670 WP_003091727.1.34689 WP_003091727.1.34784 WP_003091727.1.34821 WP_003091727.1.34832 WP_003091727.1.34836 WP_003091727.1.34837 WP_003091727.1.34876 WP_003091727.1.34878 WP_003091727.1.34901 WP_003091727.1.34922 WP_003091727.1.34942 WP_003091727.1.35036 WP_003091727.1.35104 WP_003091727.1.35149 WP_003091727.1.35231 WP_003091727.1.35281 WP_003091727.1.3531 WP_003091727.1.35325 WP_003091727.1.35353 WP_003091727.1.3540 WP_003091727.1.35431 WP_003091727.1.35442 WP_003091727.1.35480 WP_003091727.1.35512 WP_003091727.1.35529 WP_003091727.1.3555 WP_003091727.1.35573 WP_003091727.1.35599 WP_003091727.1.35639 WP_003091727.1.35641 WP_003091727.1.35669 WP_003091727.1.35679 WP_003091727.1.3568 WP_003091727.1.35682 WP_003091727.1.3576 WP_003091727.1.35762 WP_003091727.1.35768 WP_003091727.1.35822 WP_003091727.1.35843 WP_003091727.1.35857 WP_003091727.1.35872 WP_003091727.1.35968 WP_003091727.1.35984 WP_003091727.1.36064 WP_003091727.1.36121 WP_003091727.1.36148 WP_003091727.1.36170 WP_003091727.1.36266 WP_003091727.1.36267 WP_003091727.1.36285 WP_003091727.1.36378 WP_003091727.1.36435 WP_003091727.1.36487 WP_003091727.1.36521 WP_003091727.1.3653 WP_003091727.1.36587 WP_003091727.1.36608 WP_003091727.1.3662 WP_003091727.1.36630 WP_003091727.1.36665 WP_003091727.1.36708 WP_003091727.1.3672 WP_003091727.1.36756 WP_003091727.1.36781 WP_003091727.1.36879 WP_003091727.1.37050 WP_003091727.1.37097 WP_003091727.1.37125 WP_003091727.1.37163 WP_003091727.1.37172 WP_003091727.1.37208 WP_003091727.1.3721 WP_003091727.1.37216 WP_003091727.1.373 WP_003091727.1.37366 WP_003091727.1.37416 WP_003091727.1.3742 WP_003091727.1.37500 WP_003091727.1.37512 WP_003091727.1.37571 WP_003091727.1.3768 WP_003091727.1.37698 WP_003091727.1.37703 WP_003091727.1.3773 WP_003091727.1.37799 WP_003091727.1.3781 WP_003091727.1.37814 WP_003091727.1.37818 WP_003091727.1.37826 WP_003091727.1.37842 WP_003091727.1.3785 WP_003091727.1.3792 WP_003091727.1.38003 WP_003091727.1.38023 WP_003091727.1.38060 WP_003091727.1.38087 WP_003091727.1.38102 WP_003091727.1.38146 WP_003091727.1.38151 WP_003091727.1.3818 WP_003091727.1.38186 WP_003091727.1.3821 WP_003091727.1.38319 WP_003091727.1.3833 WP_003091727.1.38335 WP_003091727.1.38337 WP_003091727.1.38406 WP_003091727.1.38430 WP_003091727.1.38450 WP_003091727.1.38502 WP_003091727.1.38505 WP_003091727.1.38510 WP_003091727.1.38582 WP_003091727.1.38583 WP_003091727.1.38587 WP_003091727.1.38657 WP_003091727.1.38661 WP_003091727.1.3870 WP_003091727.1.38727 WP_003091727.1.38816 WP_003091727.1.38834 WP_003091727.1.3887 WP_003091727.1.38889 WP_003091727.1.38932 WP_003091727.1.38971 WP_003091727.1.39046 WP_003091727.1.39088 WP_003091727.1.39122 WP_003091727.1.39186 WP_003091727.1.39271 WP_003091727.1.39345 WP_003091727.1.3943 WP_003091727.1.39444 WP_003091727.1.39452 WP_003091727.1.39458 WP_003091727.1.39537 WP_003091727.1.39765 WP_003091727.1.39786 WP_003091727.1.39811 WP_003091727.1.39920 WP_003091727.1.39949 WP_003091727.1.3998 WP_003091727.1.39989 WP_003091727.1.40059 WP_003091727.1.40115 WP_003091727.1.40135 WP_003091727.1.40207 WP_003091727.1.40213 WP_003091727.1.40237 WP_003091727.1.40243 WP_003091727.1.40271 WP_003091727.1.4038 WP_003091727.1.40419 WP_003091727.1.40442 WP_003091727.1.40512 WP_003091727.1.40513 WP_003091727.1.40541 WP_003091727.1.40546 WP_003091727.1.4058 WP_003091727.1.40595 WP_003091727.1.40703 WP_003091727.1.40874 WP_003091727.1.40950 WP_003091727.1.40984 WP_003091727.1.40993 WP_003091727.1.40994 WP_003091727.1.41110 WP_003091727.1.41137 WP_003091727.1.41199 WP_003091727.1.41290 WP_003091727.1.41291 WP_003091727.1.41301 WP_003091727.1.41384 WP_003091727.1.41412 WP_003091727.1.41429 WP_003091727.1.41487 WP_003091727.1.41492 WP_003091727.1.41502 WP_003091727.1.4156 WP_003091727.1.41618 WP_003091727.1.41624 WP_003091727.1.41625 WP_003091727.1.41692 WP_003091727.1.41703 WP_003091727.1.41725 WP_003091727.1.41732 WP_003091727.1.41748 WP_003091727.1.41773 WP_003091727.1.41832 WP_003091727.1.41846 WP_003091727.1.41871 WP_003091727.1.41888 WP_003091727.1.4190 WP_003091727.1.41939 WP_003091727.1.4196 WP_003091727.1.42019 WP_003091727.1.42041 WP_003091727.1.42047 WP_003091727.1.42146 WP_003091727.1.42259 WP_003091727.1.42294 WP_003091727.1.42316 WP_003091727.1.42381 WP_003091727.1.42388 WP_003091727.1.42411 WP_003091727.1.42423 WP_003091727.1.42463 WP_003091727.1.42499 WP_003091727.1.42508 WP_003091727.1.42634 WP_003091727.1.42643 WP_003091727.1.42690 WP_003091727.1.42696 WP_003091727.1.42723 WP_003091727.1.4273 WP_003091727.1.42754 WP_003091727.1.42757 WP_003091727.1.42778 WP_003091727.1.42789 WP_003091727.1.42854 WP_003091727.1.42856 WP_003091727.1.42870 WP_003091727.1.42917 WP_003091727.1.42946 WP_003091727.1.42952 WP_003091727.1.42972 WP_003091727.1.42973 WP_003091727.1.43022 WP_003091727.1.43024 WP_003091727.1.43106 WP_003091727.1.43107 WP_003091727.1.43212 WP_003091727.1.43245 WP_003091727.1.43286 WP_003091727.1.43293 WP_003091727.1.43315 WP_003091727.1.43326 WP_003091727.1.43330 WP_003091727.1.43356 WP_003091727.1.4348 WP_003091727.1.43593 WP_003091727.1.43603 WP_003091727.1.43662 WP_003091727.1.43667 WP_003091727.1.43673 WP_003091727.1.43696 WP_003091727.1.43729 WP_003091727.1.43756 WP_003091727.1.43783 WP_003091727.1.43802 WP_003091727.1.4381 WP_003091727.1.43811 WP_003091727.1.43826 WP_003091727.1.4397 WP_003091727.1.4398 WP_003091727.1.43998 WP_003091727.1.44046 WP_003091727.1.44094 WP_003091727.1.44213 WP_003091727.1.44260 WP_003091727.1.44269 WP_003091727.1.44373 WP_003091727.1.44434 WP_003091727.1.44486 WP_003091727.1.445 WP_003091727.1.44552 WP_003091727.1.44563 WP_003091727.1.44565 WP_003091727.1.44581 WP_003091727.1.44725 WP_003091727.1.44739 WP_003091727.1.44760 WP_003091727.1.44804 WP_003091727.1.44870 WP_003091727.1.4493 WP_003091727.1.44959 WP_003091727.1.45063 WP_003091727.1.45090 WP_003091727.1.45146 WP_003091727.1.45199 WP_003091727.1.45202 WP_003091727.1.4522 WP_003091727.1.45228 WP_003091727.1.45298 WP_003091727.1.45306 WP_003091727.1.45312 WP_003091727.1.4532 WP_003091727.1.45328 WP_003091727.1.45353 WP_003091727.1.45358 WP_003091727.1.45464 WP_003091727.1.45478 WP_003091727.1.45485 WP_003091727.1.45604 WP_003091727.1.45611 WP_003091727.1.45635 WP_003091727.1.45636 WP_003091727.1.45678 WP_003091727.1.45700 WP_003091727.1.45711 WP_003091727.1.45723 WP_003091727.1.45818 WP_003091727.1.45837 WP_003091727.1.45920 WP_003091727.1.45934 WP_003091727.1.45946 WP_003091727.1.45961 WP_003091727.1.46010 WP_003091727.1.46032 WP_003091727.1.46093 WP_003091727.1.461 WP_003091727.1.46152 WP_003091727.1.46200 WP_003091727.1.46306 WP_003091727.1.4640 WP_003091727.1.46436 WP_003091727.1.46502 WP_003091727.1.46623 WP_003091727.1.46633 WP_003091727.1.46755 WP_003091727.1.46787 WP_003091727.1.46826 WP_003091727.1.46846 WP_003091727.1.46866 WP_003091727.1.46885 WP_003091727.1.46926 WP_003091727.1.46935 WP_003091727.1.4699 WP_003091727.1.47101 WP_003091727.1.47150 WP_003091727.1.47155 WP_003091727.1.47158 WP_003091727.1.47251 WP_003091727.1.4726 WP_003091727.1.47296 WP_003091727.1.47312 WP_003091727.1.47314 WP_003091727.1.47374 WP_003091727.1.47469 WP_003091727.1.47480 WP_003091727.1.47527 WP_003091727.1.47551 WP_003091727.1.47598 WP_003091727.1.47645 WP_003091727.1.47774 WP_003091727.1.47930 WP_003091727.1.47934 WP_003091727.1.47970 WP_003091727.1.48001 WP_003091727.1.48024 WP_003091727.1.48086 WP_003091727.1.48094 WP_003091727.1.48141 WP_003091727.1.48172 WP_003091727.1.48178 WP_003091727.1.48321 WP_003091727.1.48334 WP_003091727.1.4836 WP_003091727.1.48378 WP_003091727.1.48382 WP_003091727.1.48413 WP_003091727.1.48472 WP_003091727.1.48487 WP_003091727.1.48545 WP_003091727.1.48546 WP_003091727.1.48576 WP_003091727.1.48579 WP_003091727.1.48747 WP_003091727.1.48810 WP_003091727.1.48820 WP_003091727.1.48840 WP_003091727.1.48842 WP_003091727.1.48851 WP_003091727.1.48870 WP_003091727.1.48961 WP_003091727.1.49108 WP_003091727.1.4913 WP_003091727.1.49135 WP_003091727.1.49184 WP_003091727.1.49244 WP_003091727.1.49265 WP_003091727.1.49266 WP_003091727.1.49277 WP_003091727.1.49286 WP_003091727.1.49293 WP_003091727.1.49360 WP_003091727.1.49416 WP_003091727.1.49500 WP_003091727.1.49557 WP_003091727.1.49566 WP_003091727.1.49688 WP_003091727.1.49798 WP_003091727.1.49806 WP_003091727.1.49833 WP_003091727.1.49842 WP_003091727.1.49922 WP_003091727.1.49948 WP_003091727.1.49976 WP_003091727.1.49988 WP_003091727.1.49998 WP_003091727.1.50176 WP_003091727.1.50180 WP_003091727.1.50222 WP_003091727.1.50232 WP_003091727.1.50242 WP_003091727.1.5043 WP_003091727.1.50450 WP_003091727.1.50459 WP_003091727.1.50567 WP_003091727.1.50653 WP_003091727.1.50665 WP_003091727.1.50668 WP_003091727.1.50682 WP_003091727.1.50691 WP_003091727.1.50734 WP_003091727.1.50783 WP_003091727.1.50814 WP_003091727.1.50967 WP_003091727.1.50989 WP_003091727.1.51019 WP_003091727.1.51035 WP_003091727.1.51136 WP_003091727.1.51141 WP_003091727.1.51173 WP_003091727.1.51183 WP_003091727.1.51185 WP_003091727.1.51267 WP_003091727.1.51273 WP_003091727.1.5132 WP_003091727.1.51457 WP_003091727.1.51472 WP_003091727.1.51501 WP_003091727.1.51538 WP_003091727.1.51549 WP_003091727.1.51585 WP_003091727.1.51682 WP_003091727.1.51727 WP_003091727.1.51733 WP_003091727.1.51807 WP_003091727.1.51889 WP_003091727.1.51917 WP_003091727.1.51928 WP_003091727.1.51937 WP_003091727.1.51943 WP_003091727.1.51957 WP_003091727.1.51976 WP_003091727.1.52043 WP_003091727.1.52146 WP_003091727.1.52152 WP_003091727.1.52212 WP_003091727.1.52220 WP_003091727.1.52244 WP_003091727.1.5226 WP_003091727.1.52326 WP_003091727.1.52334 WP_003091727.1.5235 WP_003091727.1.52355 WP_003091727.1.52372 WP_003091727.1.52403 WP_003091727.1.52409 WP_003091727.1.52449 WP_003091727.1.52500 WP_003091727.1.52537 WP_003091727.1.5258 WP_003091727.1.52583 WP_003091727.1.52591 WP_003091727.1.5260 WP_003091727.1.52690 WP_003091727.1.52697 WP_003091727.1.52700 WP_003091727.1.52728 WP_003091727.1.52784 WP_003091727.1.52790 WP_003091727.1.52810 WP_003091727.1.52850 WP_003091727.1.5289 WP_003091727.1.52939 WP_003091727.1.5294 WP_003091727.1.53037 WP_003091727.1.53038 WP_003091727.1.53070 WP_003091727.1.53169 WP_003091727.1.53267 WP_003091727.1.53287 WP_003091727.1.53351 WP_003091727.1.53414 WP_003091727.1.53427 WP_003091727.1.53486 WP_003091727.1.53528 WP_003091727.1.53530 WP_003091727.1.53586 WP_003091727.1.53663 WP_003091727.1.53678 WP_003091727.1.53719 WP_003091727.1.53726 WP_003091727.1.53826 WP_003091727.1.5388 WP_003091727.1.53932 WP_003091727.1.53946 WP_003091727.1.53948 WP_003091727.1.53951 WP_003091727.1.5399 WP_003091727.1.54003 WP_003091727.1.54076 WP_003091727.1.54078 WP_003091727.1.54090 WP_003091727.1.54133 WP_003091727.1.54140 WP_003091727.1.54146 WP_003091727.1.5420 WP_003091727.1.54248 WP_003091727.1.5427 WP_003091727.1.54293 WP_003091727.1.54354 WP_003091727.1.54462 WP_003091727.1.54497 WP_003091727.1.54571 WP_003091727.1.54742 WP_003091727.1.54809 WP_003091727.1.54974 WP_003091727.1.55 WP_003091727.1.55089 WP_003091727.1.55169 WP_003091727.1.55318 WP_003091727.1.55347 WP_003091727.1.55387 WP_003091727.1.55400 WP_003091727.1.55445 WP_003091727.1.55478 WP_003091727.1.55543 WP_003091727.1.55813 WP_003091727.1.55976 WP_003091727.1.56013 WP_003091727.1.56037 WP_003091727.1.56145 WP_003091727.1.56171 WP_003091727.1.56187 WP_003091727.1.56188 WP_003091727.1.56196 WP_003091727.1.56229 WP_003091727.1.56315 WP_003091727.1.56348 WP_003091727.1.56442 WP_003091727.1.56452 WP_003091727.1.56465 WP_003091727.1.56474 WP_003091727.1.56475 WP_003091727.1.56623 WP_003091727.1.56626 WP_003091727.1.56632 WP_003091727.1.56745 WP_003091727.1.56768 WP_003091727.1.56797 WP_003091727.1.56808 WP_003091727.1.56819 WP_003091727.1.56837 WP_003091727.1.56864 WP_003091727.1.56896 WP_003091727.1.56973 WP_003091727.1.57005 WP_003091727.1.57020 WP_003091727.1.57065 WP_003091727.1.57113 WP_003091727.1.57131 WP_003091727.1.57140 WP_003091727.1.57276 WP_003091727.1.5731 WP_003091727.1.57339 WP_003091727.1.57369 WP_003091727.1.57417 WP_003091727.1.57460 WP_003091727.1.57477 WP_003091727.1.57480 WP_003091727.1.57532 WP_003091727.1.57548 WP_003091727.1.57566 WP_003091727.1.57728 WP_003091727.1.57792 WP_003091727.1.57839 WP_003091727.1.57841 WP_003091727.1.57853 WP_003091727.1.57921 WP_003091727.1.57966 WP_003091727.1.58019 WP_003091727.1.58056 WP_003091727.1.58155 WP_003091727.1.58162 WP_003091727.1.58183 WP_003091727.1.58193 WP_003091727.1.58200 WP_003091727.1.58228 WP_003091727.1.58294 WP_003091727.1.58360 WP_003091727.1.58417 WP_003091727.1.58436 WP_003091727.1.58482 WP_003091727.1.5850 WP_003091727.1.58510 WP_003091727.1.58527 WP_003091727.1.5856 WP_003091727.1.58581 WP_003091727.1.58689 WP_003091727.1.5869 WP_003091727.1.58785 WP_003091727.1.58800 WP_003091727.1.58838 WP_003091727.1.58845 WP_003091727.1.5889 WP_003091727.1.58944 WP_003091727.1.58952 WP_003091727.1.5897 WP_003091727.1.59013 WP_003091727.1.59076 WP_003091727.1.59099 WP_003091727.1.59123 WP_003091727.1.59156 WP_003091727.1.59158 WP_003091727.1.59176 WP_003091727.1.59212 WP_003091727.1.59246 WP_003091727.1.59250 WP_003091727.1.59288 WP_003091727.1.59339 WP_003091727.1.5937 WP_003091727.1.59376 WP_003091727.1.59385 WP_003091727.1.594 WP_003091727.1.59469 WP_003091727.1.59563 WP_003091727.1.59688 WP_003091727.1.59724 WP_003091727.1.59759 WP_003091727.1.59797 WP_003091727.1.59831 WP_003091727.1.59870 WP_003091727.1.59943 WP_003091727.1.60051 WP_003091727.1.60062 WP_003091727.1.60079 WP_003091727.1.60082 WP_003091727.1.60084 WP_003091727.1.60085 WP_003091727.1.60206 WP_003091727.1.60261 WP_003091727.1.60347 WP_003091727.1.60364 WP_003091727.1.60396 WP_003091727.1.60415 WP_003091727.1.60467 WP_003091727.1.60472 WP_003091727.1.60509 WP_003091727.1.60600 WP_003091727.1.60602 WP_003091727.1.60603 WP_003091727.1.60639 WP_003091727.1.60679 WP_003091727.1.60686 WP_003091727.1.607 WP_003091727.1.60850 WP_003091727.1.60910 WP_003091727.1.60916 WP_003091727.1.60970 WP_003091727.1.60979 WP_003091727.1.61122 WP_003091727.1.61130 WP_003091727.1.61191 WP_003091727.1.61209 WP_003091727.1.61222 WP_003091727.1.61269 WP_003091727.1.61294 WP_003091727.1.61299 WP_003091727.1.6130 WP_003091727.1.61366 WP_003091727.1.61431 WP_003091727.1.61493 WP_003091727.1.61549 WP_003091727.1.61589 WP_003091727.1.61598 WP_003091727.1.616 WP_003091727.1.61696 WP_003091727.1.6173 WP_003091727.1.61943 WP_003091727.1.62010 WP_003091727.1.62035 WP_003091727.1.62186 WP_003091727.1.62211 WP_003091727.1.62263 WP_003091727.1.62357 WP_003091727.1.62396 WP_003091727.1.62410 WP_003091727.1.6242 WP_003091727.1.62483 WP_003091727.1.62516 WP_003091727.1.62534 WP_003091727.1.626 WP_003091727.1.62604 WP_003091727.1.62635 WP_003091727.1.62688 WP_003091727.1.62701 WP_003091727.1.62703 WP_003091727.1.62704 WP_003091727.1.62708 WP_003091727.1.62716 WP_003091727.1.62768 WP_003091727.1.62772 WP_003091727.1.6280 WP_003091727.1.62834 WP_003091727.1.62838 WP_003091727.1.62873 WP_003091727.1.62917 WP_003091727.1.62961 WP_003091727.1.62977 WP_003091727.1.63038 WP_003091727.1.63041 WP_003091727.1.63057 WP_003091727.1.63124 WP_003091727.1.63193 WP_003091727.1.63196 WP_003091727.1.63338 WP_003091727.1.63369 WP_003091727.1.63401 WP_003091727.1.63591 WP_003091727.1.63597 WP_003091727.1.63634 WP_003091727.1.63659 WP_003091727.1.63739 WP_003091727.1.63784 WP_003091727.1.63929 WP_003091727.1.63941 WP_003091727.1.63995 WP_003091727.1.64139 WP_003091727.1.64155 WP_003091727.1.64198 WP_003091727.1.64212 WP_003091727.1.64309 WP_003091727.1.64329 WP_003091727.1.64340 WP_003091727.1.64433 WP_003091727.1.6450 WP_003091727.1.64544 WP_003091727.1.64591 WP_003091727.1.64603 WP_003091727.1.64605 WP_003091727.1.6461 WP_003091727.1.64611 WP_003091727.1.64726 WP_003091727.1.64748 WP_003091727.1.64807 WP_003091727.1.64854 WP_003091727.1.64862 WP_003091727.1.64880 WP_003091727.1.64885 WP_003091727.1.64886 WP_003091727.1.64983 WP_003091727.1.64984 WP_003091727.1.65009 WP_003091727.1.65066 WP_003091727.1.65092 WP_003091727.1.65095 WP_003091727.1.65099 WP_003091727.1.65145 WP_003091727.1.65196 WP_003091727.1.65227 WP_003091727.1.65237 WP_003091727.1.65247 WP_003091727.1.65285 WP_003091727.1.65304 WP_003091727.1.65312 WP_003091727.1.65316 WP_003091727.1.65334 WP_003091727.1.65335 WP_003091727.1.65337 WP_003091727.1.65457 WP_003091727.1.65478 WP_003091727.1.65549 WP_003091727.1.65588 WP_003091727.1.65632 WP_003091727.1.65642 WP_003091727.1.65679 WP_003091727.1.65740 WP_003091727.1.65779 WP_003091727.1.65819 WP_003091727.1.65867 WP_003091727.1.6589 WP_003091727.1.65926 WP_003091727.1.66062 WP_003091727.1.66088 WP_003091727.1.66155 WP_003091727.1.66165 WP_003091727.1.6627 WP_003091727.1.66277 WP_003091727.1.6629 WP_003091727.1.66345 WP_003091727.1.66348 WP_003091727.1.66364 WP_003091727.1.66371 WP_003091727.1.66410 WP_003091727.1.66526 WP_003091727.1.66563 WP_003091727.1.66634 WP_003091727.1.66693 WP_003091727.1.66721 WP_003091727.1.66892 WP_003091727.1.66929 WP_003091727.1.66931 WP_003091727.1.66945 WP_003091727.1.66950 WP_003091727.1.66982 WP_003091727.1.67010 WP_003091727.1.67124 WP_003091727.1.67188 WP_003091727.1.67192 WP_003091727.1.67205 WP_003091727.1.67261 WP_003091727.1.67269 WP_003091727.1.6734 WP_003091727.1.67370 WP_003091727.1.67388 WP_003091727.1.67472 WP_003091727.1.67489 WP_003091727.1.67506 WP_003091727.1.67526 WP_003091727.1.67531 WP_003091727.1.67545 WP_003091727.1.6768 WP_003091727.1.67686 WP_003091727.1.67755 WP_003091727.1.67830 WP_003091727.1.67874 WP_003091727.1.67875 WP_003091727.1.67899 WP_003091727.1.67937 WP_003091727.1.67948 WP_003091727.1.6796 WP_003091727.1.68000 WP_003091727.1.6808 WP_003091727.1.68158 WP_003091727.1.68162 WP_003091727.1.68172 WP_003091727.1.68183 WP_003091727.1.68194 WP_003091727.1.68252 WP_003091727.1.68317 WP_003091727.1.68446 WP_003091727.1.68448 WP_003091727.1.68472 WP_003091727.1.68499 WP_003091727.1.6850 WP_003091727.1.68541 WP_003091727.1.68561 WP_003091727.1.68568 WP_003091727.1.68638 WP_003091727.1.6866 WP_003091727.1.68756 WP_003091727.1.68781 WP_003091727.1.68790 WP_003091727.1.68800 WP_003091727.1.68802 WP_003091727.1.68850 WP_003091727.1.68857 WP_003091727.1.68862 WP_003091727.1.68881 WP_003091727.1.68910 WP_003091727.1.68938 WP_003091727.1.68979 WP_003091727.1.69088 WP_003091727.1.6911 WP_003091727.1.69159 WP_003091727.1.69209 WP_003091727.1.69260 WP_003091727.1.6931 WP_003091727.1.69330 WP_003091727.1.6937 WP_003091727.1.69411 WP_003091727.1.69534 WP_003091727.1.69556 WP_003091727.1.69599 WP_003091727.1.69702 WP_003091727.1.69788 WP_003091727.1.69791 WP_003091727.1.69819 WP_003091727.1.69834 WP_003091727.1.69907 WP_003091727.1.69993 WP_003091727.1.70092 WP_003091727.1.70098 WP_003091727.1.70138 WP_003091727.1.70168 WP_003091727.1.70194 WP_003091727.1.70216 WP_003091727.1.70229 WP_003091727.1.70331 WP_003091727.1.70460 WP_003091727.1.70470 WP_003091727.1.70537 WP_003091727.1.70561 WP_003091727.1.70583 WP_003091727.1.70648 WP_003091727.1.70650 WP_003091727.1.70670 WP_003091727.1.70677 WP_003091727.1.70693 WP_003091727.1.7077 WP_003091727.1.70778 WP_003091727.1.70991 WP_003091727.1.71038 WP_003091727.1.71141 WP_003091727.1.71203 WP_003091727.1.71234 WP_003091727.1.71249 WP_003091727.1.71254 WP_003091727.1.7128 WP_003091727.1.71290 WP_003091727.1.71346 WP_003091727.1.71385 WP_003091727.1.71412 WP_003091727.1.71570 WP_003091727.1.71610 WP_003091727.1.7163 WP_003091727.1.71642 WP_003091727.1.71666 WP_003091727.1.71738 WP_003091727.1.71799 WP_003091727.1.71806 WP_003091727.1.71822 WP_003091727.1.71862 WP_003091727.1.71866 WP_003091727.1.71891 WP_003091727.1.71927 WP_003091727.1.72149 WP_003091727.1.72167 WP_003091727.1.72181 WP_003091727.1.72183 WP_003091727.1.7219 WP_003091727.1.72287 WP_003091727.1.72323 WP_003091727.1.72331 WP_003091727.1.72346 WP_003091727.1.72378 WP_003091727.1.72447 WP_003091727.1.72458 WP_003091727.1.72477 WP_003091727.1.72541 WP_003091727.1.72562 WP_003091727.1.72570 WP_003091727.1.72653 WP_003091727.1.72662 WP_003091727.1.72669 WP_003091727.1.72727 WP_003091727.1.7276 WP_003091727.1.72768 WP_003091727.1.72772 WP_003091727.1.72782 WP_003091727.1.72845 WP_003091727.1.72920 WP_003091727.1.73035 WP_003091727.1.73048 WP_003091727.1.7308 WP_003091727.1.73135 WP_003091727.1.73149 WP_003091727.1.73172 WP_003091727.1.73192 WP_003091727.1.7327 WP_003091727.1.7329 WP_003091727.1.733 WP_003091727.1.73455 WP_003091727.1.73490 WP_003091727.1.73523 WP_003091727.1.73541 WP_003091727.1.73651 WP_003091727.1.73719 WP_003091727.1.7377 WP_003091727.1.73791 WP_003091727.1.7382 WP_003091727.1.73860 WP_003091727.1.73889 WP_003091727.1.73911 WP_003091727.1.73941 WP_003091727.1.74 WP_003091727.1.74000 WP_003091727.1.74072 WP_003091727.1.74074 WP_003091727.1.7408 WP_003091727.1.74106 WP_003091727.1.74167 WP_003091727.1.74175 WP_003091727.1.74180 WP_003091727.1.74182 WP_003091727.1.74219 WP_003091727.1.74264 WP_003091727.1.74268 WP_003091727.1.74281 WP_003091727.1.74287 WP_003091727.1.74326 WP_003091727.1.7445 WP_003091727.1.74458 WP_003091727.1.74473 WP_003091727.1.74475 WP_003091727.1.7448 WP_003091727.1.74518 WP_003091727.1.7456 WP_003091727.1.74568 WP_003091727.1.74604 WP_003091727.1.74629 WP_003091727.1.74637 WP_003091727.1.74685 WP_003091727.1.74772 WP_003091727.1.74776 WP_003091727.1.748 WP_003091727.1.74878 WP_003091727.1.74941 WP_003091727.1.74948 WP_003091727.1.74958 WP_003091727.1.7501 WP_003091727.1.75041 WP_003091727.1.75119 WP_003091727.1.75204 WP_003091727.1.75303 WP_003091727.1.75389 WP_003091727.1.75431 WP_003091727.1.7547 WP_003091727.1.75549 WP_003091727.1.75573 WP_003091727.1.75580 WP_003091727.1.75599 WP_003091727.1.75603 WP_003091727.1.75631 WP_003091727.1.7568 WP_003091727.1.75756 WP_003091727.1.75771 WP_003091727.1.75792 WP_003091727.1.75825 WP_003091727.1.75826 WP_003091727.1.75860 WP_003091727.1.75935 WP_003091727.1.75938 WP_003091727.1.75947 WP_003091727.1.7595 WP_003091727.1.76077 WP_003091727.1.76092 WP_003091727.1.76141 WP_003091727.1.76145 WP_003091727.1.76192 WP_003091727.1.76322 WP_003091727.1.76355 WP_003091727.1.76383 WP_003091727.1.76399 WP_003091727.1.76441 WP_003091727.1.76467 WP_003091727.1.76484 WP_003091727.1.76600 WP_003091727.1.76633 WP_003091727.1.7666 WP_003091727.1.76716 WP_003091727.1.76775 WP_003091727.1.76791 WP_003091727.1.76861 WP_003091727.1.76922 WP_003091727.1.76985 WP_003091727.1.77235 WP_003091727.1.77238 WP_003091727.1.77286 WP_003091727.1.77317 WP_003091727.1.77442 WP_003091727.1.77476 WP_003091727.1.77490 WP_003091727.1.77566 WP_003091727.1.77574 WP_003091727.1.77686 WP_003091727.1.77750 WP_003091727.1.77769 WP_003091727.1.7779 WP_003091727.1.77819 WP_003091727.1.77834 WP_003091727.1.77913 WP_003091727.1.78104 WP_003091727.1.78112 WP_003091727.1.78118 WP_003091727.1.78134 WP_003091727.1.78148 WP_003091727.1.78158 WP_003091727.1.78280 WP_003091727.1.78288 WP_003091727.1.78380 WP_003091727.1.7840 WP_003091727.1.78409 WP_003091727.1.78425 WP_003091727.1.78430 WP_003091727.1.78437 WP_003091727.1.78570 WP_003091727.1.78599 WP_003091727.1.78623 WP_003091727.1.78669 WP_003091727.1.78693 WP_003091727.1.78795 WP_003091727.1.788 WP_003091727.1.78810 WP_003091727.1.78926 WP_003091727.1.78947 WP_003091727.1.78954 WP_003091727.1.78986 WP_003091727.1.7899 WP_003091727.1.79003 WP_003091727.1.79007 WP_003091727.1.79053 WP_003091727.1.79060 WP_003091727.1.79177 WP_003091727.1.79193 WP_003091727.1.79256 WP_003091727.1.79279 WP_003091727.1.79286 WP_003091727.1.79311 WP_003091727.1.79357 WP_003091727.1.79364 WP_003091727.1.79421 WP_003091727.1.79429 WP_003091727.1.79431 WP_003091727.1.7945 WP_003091727.1.79463 WP_003091727.1.79507 WP_003091727.1.7953 WP_003091727.1.79544 WP_003091727.1.79569 WP_003091727.1.79601 WP_003091727.1.79631 WP_003091727.1.79699 WP_003091727.1.79754 WP_003091727.1.79788 WP_003091727.1.79862 WP_003091727.1.79883 WP_003091727.1.799 WP_003091727.1.79902 WP_003091727.1.79908 WP_003091727.1.79986 WP_003091727.1.8 WP_003091727.1.80033 WP_003091727.1.80068 WP_003091727.1.80087 WP_003091727.1.80102 WP_003091727.1.8013 WP_003091727.1.80174 WP_003091727.1.80258 WP_003091727.1.8028 WP_003091727.1.80306 WP_003091727.1.8038 WP_003091727.1.80410 WP_003091727.1.80411 WP_003091727.1.80454 WP_003091727.1.80481 WP_003091727.1.8051 WP_003091727.1.80535 WP_003091727.1.80572 WP_003091727.1.80627 WP_003091727.1.80632 WP_003091727.1.8064 WP_003091727.1.80644 WP_003091727.1.80645 WP_003091727.1.80683 WP_003091727.1.80715 WP_003091727.1.80720 WP_003091727.1.80785 WP_003091727.1.80846 WP_003091727.1.80880 WP_003091727.1.80892 WP_003091727.1.80910 WP_003091727.1.80926 WP_003091727.1.80929 WP_003091727.1.80931 WP_003091727.1.80938 WP_003091727.1.80969 WP_003091727.1.81081 WP_003091727.1.81082 WP_003091727.1.8110 WP_003091727.1.81206 WP_003091727.1.81237 WP_003091727.1.81331 WP_003091727.1.81338 WP_003091727.1.81349 WP_003091727.1.81368 WP_003091727.1.81380 WP_003091727.1.8141 WP_003091727.1.81426 WP_003091727.1.81470 WP_003091727.1.81482 WP_003091727.1.81487 WP_003091727.1.81581 WP_003091727.1.81591 WP_003091727.1.81643 WP_003091727.1.81708 WP_003091727.1.81728 WP_003091727.1.81742 WP_003091727.1.81748 WP_003091727.1.81771 WP_003091727.1.81784 WP_003091727.1.81802 WP_003091727.1.81816 WP_003091727.1.81834 WP_003091727.1.81844 WP_003091727.1.81856 WP_003091727.1.81874 WP_003091727.1.81927 WP_003091727.1.81950 WP_003091727.1.81957 WP_003091727.1.81960 WP_003091727.1.81986 WP_003091727.1.82117 WP_003091727.1.82127 WP_003091727.1.82178 WP_003091727.1.82260 WP_003091727.1.8227 WP_003091727.1.82310 WP_003091727.1.82312 WP_003091727.1.82328 WP_003091727.1.82334 WP_003091727.1.8238 WP_003091727.1.82442 WP_003091727.1.82487 WP_003091727.1.82580 WP_003091727.1.82604 WP_003091727.1.82606 WP_003091727.1.82620 WP_003091727.1.82643 WP_003091727.1.82686 WP_003091727.1.82710 WP_003091727.1.82798 WP_003091727.1.82810 WP_003091727.1.8284 WP_003091727.1.82864 WP_003091727.1.82882 WP_003091727.1.82887 WP_003091727.1.82936 WP_003091727.1.83025 WP_003091727.1.83131 WP_003091727.1.83184 WP_003091727.1.83213 WP_003091727.1.83251 WP_003091727.1.83267 WP_003091727.1.83296 WP_003091727.1.83317 WP_003091727.1.83374 WP_003091727.1.83394 WP_003091727.1.83440 WP_003091727.1.83460 WP_003091727.1.83463 WP_003091727.1.835 WP_003091727.1.83503 WP_003091727.1.8351 WP_003091727.1.8353 WP_003091727.1.83534 WP_003091727.1.83540 WP_003091727.1.8357 WP_003091727.1.83637 WP_003091727.1.83673 WP_003091727.1.83698 WP_003091727.1.83715 WP_003091727.1.83871 WP_003091727.1.83937 WP_003091727.1.83946 WP_003091727.1.84003 WP_003091727.1.84008 WP_003091727.1.84138 WP_003091727.1.84162 WP_003091727.1.84174 WP_003091727.1.84177 WP_003091727.1.84178 WP_003091727.1.84190 WP_003091727.1.84203 WP_003091727.1.84271 WP_003091727.1.84297 WP_003091727.1.84374 WP_003091727.1.84398 WP_003091727.1.84439 WP_003091727.1.84471 WP_003091727.1.84487 WP_003091727.1.84526 WP_003091727.1.8453 WP_003091727.1.84538 WP_003091727.1.84558 WP_003091727.1.84589 WP_003091727.1.84674 WP_003091727.1.84684 WP_003091727.1.84702 WP_003091727.1.84715 WP_003091727.1.84754 WP_003091727.1.84792 WP_003091727.1.84825 WP_003091727.1.8484 WP_003091727.1.84865 WP_003091727.1.84937 WP_003091727.1.84946 WP_003091727.1.8498 WP_003091727.1.85018 WP_003091727.1.85028 WP_003091727.1.85059 WP_003091727.1.85150 WP_003091727.1.85220 WP_003091727.1.85290 WP_003091727.1.85298 WP_003091727.1.85303 WP_003091727.1.85311 WP_003091727.1.85318 WP_003091727.1.85357 WP_003091727.1.85446 WP_003091727.1.85453 WP_003091727.1.85574 WP_003091727.1.85633 WP_003091727.1.85638 WP_003091727.1.85897 WP_003091727.1.85910 WP_003091727.1.85920 WP_003091727.1.85978 WP_003091727.1.86002 WP_003091727.1.86047 WP_003091727.1.86055 WP_003091727.1.86058 WP_003091727.1.86125 WP_003091727.1.86182 WP_003091727.1.86243 WP_003091727.1.86278 WP_003091727.1.86287 WP_003091727.1.86293 WP_003091727.1.86386 WP_003091727.1.86432 WP_003091727.1.8645 WP_003091727.1.865 WP_003091727.1.86506 WP_003091727.1.86545 WP_003091727.1.86552 WP_003091727.1.86554 WP_003091727.1.86595 WP_003091727.1.86652 WP_003091727.1.86665 WP_003091727.1.867 WP_003091727.1.86708 WP_003091727.1.86733 WP_003091727.1.86774 WP_003091727.1.86780 WP_003091727.1.86785 WP_003091727.1.86796 WP_003091727.1.86813 WP_003091727.1.86822 WP_003091727.1.8693 WP_003091727.1.86947 WP_003091727.1.86970 WP_003091727.1.86985 WP_003091727.1.87104 WP_003091727.1.8718 WP_003091727.1.87182 WP_003091727.1.87183 WP_003091727.1.8727 WP_003091727.1.87316 WP_003091727.1.87390 WP_003091727.1.87435 WP_003091727.1.87463 WP_003091727.1.8749 WP_003091727.1.87530 WP_003091727.1.87547 WP_003091727.1.87648 WP_003091727.1.87763 WP_003091727.1.8777 WP_003091727.1.8785 WP_003091727.1.87877 WP_003091727.1.87888 WP_003091727.1.87970 WP_003091727.1.87975 WP_003091727.1.87981 WP_003091727.1.87987 WP_003091727.1.88004 WP_003091727.1.88152 WP_003091727.1.88308 WP_003091727.1.88330 WP_003091727.1.88360 WP_003091727.1.88388 WP_003091727.1.88415 WP_003091727.1.88517 WP_003091727.1.8852 WP_003091727.1.88540 WP_003091727.1.88550 WP_003091727.1.88578 WP_003091727.1.88605 WP_003091727.1.88659 WP_003091727.1.88679 WP_003091727.1.88680 WP_003091727.1.88714 WP_003091727.1.88750 WP_003091727.1.88796 WP_003091727.1.889 WP_003091727.1.88900 WP_003091727.1.88949 WP_003091727.1.88969 WP_003091727.1.89083 WP_003091727.1.89098 WP_003091727.1.8911 WP_003091727.1.89234 WP_003091727.1.89245 WP_003091727.1.89266 WP_003091727.1.89276 WP_003091727.1.89330 WP_003091727.1.89409 WP_003091727.1.89434 WP_003091727.1.89440 WP_003091727.1.8949 WP_003091727.1.89491 WP_003091727.1.89523 WP_003091727.1.89577 WP_003091727.1.89610 WP_003091727.1.89662 WP_003091727.1.89669 WP_003091727.1.89736 WP_003091727.1.8976 WP_003091727.1.89776 WP_003091727.1.89805 WP_003091727.1.89866 WP_003091727.1.89867 WP_003091727.1.89868 WP_003091727.1.89871 WP_003091727.1.89886 WP_003091727.1.89992 WP_003091727.1.90024 WP_003091727.1.90056 WP_003091727.1.90110 WP_003091727.1.90141 WP_003091727.1.90150 WP_003091727.1.90189 WP_003091727.1.90224 WP_003091727.1.90225 WP_003091727.1.90242 WP_003091727.1.90268 WP_003091727.1.90272 WP_003091727.1.90306 WP_003091727.1.90412 WP_003091727.1.9056 WP_003091727.1.90569 WP_003091727.1.90655 WP_003091727.1.90770 WP_003091727.1.90940 WP_003091727.1.90999 WP_003091727.1.91012 WP_003091727.1.91093 WP_003091727.1.91161 WP_003091727.1.9120 WP_003091727.1.91204 WP_003091727.1.91236 WP_003091727.1.91281 WP_003091727.1.91307 WP_003091727.1.91336 WP_003091727.1.91360 WP_003091727.1.91392 WP_003091727.1.91416 WP_003091727.1.9143 WP_003091727.1.91431 WP_003091727.1.91438 WP_003091727.1.91467 WP_003091727.1.91527 WP_003091727.1.91563 WP_003091727.1.91585 WP_003091727.1.91796 WP_003091727.1.91803 WP_003091727.1.9182 WP_003091727.1.91838 WP_003091727.1.91846 WP_003091727.1.91860 WP_003091727.1.91862 WP_003091727.1.91882 WP_003091727.1.9191 WP_003091727.1.91938 WP_003091727.1.91943 WP_003091727.1.91996 WP_003091727.1.92043 WP_003091727.1.92175 WP_003091727.1.9219 WP_003091727.1.92314 WP_003091727.1.92321 WP_003091727.1.92357 WP_003091727.1.92454 WP_003091727.1.92573 WP_003091727.1.92585 WP_003091727.1.92587 WP_003091727.1.92589 WP_003091727.1.92594 WP_003091727.1.92624 WP_003091727.1.92630 WP_003091727.1.92642 WP_003091727.1.9272 WP_003091727.1.92759 WP_003091727.1.92769 WP_003091727.1.92839 WP_003091727.1.92847 WP_003091727.1.92894 WP_003091727.1.92924 WP_003091727.1.92930 WP_003091727.1.93001 WP_003091727.1.93122 WP_003091727.1.93130 WP_003091727.1.93144 WP_003091727.1.93148 WP_003091727.1.93196 WP_003091727.1.93250 WP_003091727.1.93264 WP_003091727.1.9328 WP_003091727.1.93446 WP_003091727.1.9349 WP_003091727.1.93493 WP_003091727.1.93498 WP_003091727.1.93520 WP_003091727.1.93547 WP_003091727.1.93562 WP_003091727.1.93568 WP_003091727.1.93797 WP_003091727.1.93848 WP_003091727.1.93889 WP_003091727.1.93897 WP_003091727.1.94004 WP_003091727.1.94031 WP_003091727.1.94065 WP_003091727.1.94078 WP_003091727.1.94136 WP_003091727.1.94174 WP_003091727.1.94211 WP_003091727.1.94218 WP_003091727.1.94221 WP_003091727.1.94230 WP_003091727.1.94243 WP_003091727.1.94285 WP_003091727.1.94288 WP_003091727.1.94333 WP_003091727.1.94349 WP_003091727.1.94385 WP_003091727.1.94422 WP_003091727.1.94434 WP_003091727.1.9444 WP_003091727.1.94450 WP_003091727.1.94682 WP_003091727.1.94732 WP_003091727.1.94742 WP_003091727.1.94814 WP_003091727.1.94818 WP_003091727.1.94856 WP_003091727.1.94874 WP_003091727.1.94881 WP_003091727.1.94896 WP_003091727.1.94897 WP_003091727.1.94943 WP_003091727.1.95018 WP_003091727.1.95025 WP_003091727.1.95027 WP_003091727.1.95056 WP_003091727.1.95117 WP_003091727.1.95132 WP_003091727.1.95187 WP_003091727.1.95207 WP_003091727.1.95217 WP_003091727.1.95305 WP_003091727.1.95324 WP_003091727.1.95359 WP_003091727.1.95460 WP_003091727.1.95488 WP_003091727.1.95525 WP_003091727.1.95536 WP_003091727.1.95638 WP_003091727.1.95668 WP_003091727.1.95745 WP_003091727.1.95751 WP_003091727.1.95774 WP_003091727.1.95782 WP_003091727.1.95802 WP_003091727.1.95820 WP_003091727.1.95825 WP_003091727.1.95959 WP_003091727.1.9599 WP_003091727.1.95994 WP_003091727.1.95999 WP_003091727.1.96008 WP_003091727.1.9604 WP_003091727.1.96041 WP_003091727.1.96058 WP_003091727.1.961 WP_003091727.1.96193 WP_003091727.1.96243 WP_003091727.1.96267 WP_003091727.1.96357 WP_003091727.1.96384 WP_003091727.1.96434 WP_003091727.1.96452 WP_003091727.1.96506 WP_003091727.1.96667 WP_003091727.1.96702 WP_003091727.1.96714 WP_003091727.1.96863 WP_003091727.1.96880 WP_003091727.1.96967 WP_003091727.1.9706 WP_003091727.1.97118 WP_003091727.1.97126 WP_003091727.1.97204 WP_003091727.1.97213 WP_003091727.1.9722 WP_003091727.1.97271 WP_003091727.1.97272 WP_003091727.1.97377 WP_003091727.1.97461 WP_003091727.1.97474 WP_003091727.1.97488 WP_003091727.1.97499 WP_003091727.1.97503 WP_003091727.1.97521 WP_003091727.1.97583 WP_003091727.1.97614 WP_003091727.1.977 WP_003091727.1.97784 WP_003091727.1.97826 WP_003091727.1.97877 WP_003091727.1.97968 WP_003091727.1.98111 WP_003091727.1.98260 WP_003091727.1.98276 WP_003091727.1.98308 WP_003091727.1.98410 WP_003091727.1.98414 WP_003091727.1.98433 WP_003091727.1.9845 WP_003091727.1.985 WP_003091727.1.98515 WP_003091727.1.98522 WP_003091727.1.98573 WP_003091727.1.98600 WP_003091727.1.98610 WP_003091727.1.98672 WP_003091727.1.98678 WP_003091727.1.98693 WP_003091727.1.98718 WP_003091727.1.98788 WP_003091727.1.9885 WP_003091727.1.98873 WP_003091727.1.98907 WP_003091727.1.98926 WP_003091727.1.98960 WP_003091727.1.98963 WP_003091727.1.99065 WP_003091727.1.99068 WP_003091727.1.99103 WP_003091727.1.99214 WP_003091727.1.99293 WP_003091727.1.99353 WP_003091727.1.99378 WP_003091727.1.99386 WP_003091727.1.99389 WP_003091727.1.99443 WP_003091727.1.99461 WP_003091727.1.9951 WP_003091727.1.99516 WP_003091727.1.99647 WP_003091727.1.99654 WP_003091727.1.99662 WP_003091727.1.99746 WP_003091727.1.99757 WP_003091727.1.99772 WP_003091727.1.99795 WP_003091727.1.99835 WP_003091727.1.9989 WP_003091727.1.99930 gi|218890457|ref|YP_002439321.1| gi|478477801|ref|YP_007708452.1| gi|386057685|ref|YP_005974207.1| gi|15598543|ref|NP_252037.1| gi|568152863|ref|YP_008941819.1| gi|568308438|ref|YP_008980707.1| gi|386067383|ref|YP_005982687.1| gi|558673476|ref|YP_008810184.1| gi|564951506|ref|YP_008884076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]