SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376492 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376492
Domain Number 1 Region: 5-85
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000235
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 376492
Sequence length 93
Comment $ JCSG $ SQ128635 $ PDBT33818 $
Sequence
MSENTVELGSELTIRNIQPIYSQLADLLHQGRPVTLNAARLIKADTAGLQLLLCLQSHCE
NSSIPLNWKGITTELVAQFKQMGMQLPGITSQA
Download sequence
Identical sequences A1SBD9
326297.Sama_3493 376492 gi|119776625|ref|YP_929365.1| WP_011761599.1.25267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]