SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 376494 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  376494
Domain Number 1 Region: 25-90
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000104
Family Anti-sigma factor antagonist SpoIIaa 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 376494
Sequence length 92
Comment $ JCSG $ SQ128258 $ PDBT33819 $
Sequence
MHTELKNGTLHIGGDITVKTLTGDAFGRFRQQCRLKETIAVDFGGVKRADSACMSLLLEV
LRGCKGSVRLTGIPESVRALSELYEIKDWLKS
Download sequence
Identical sequences A0A1D3EFA0 Q5F519
376494 242231.NGO2120 WP_003687106.1.100674 WP_003687106.1.11215 WP_003687106.1.13586 WP_003687106.1.13918 WP_003687106.1.15676 WP_003687106.1.15865 WP_003687106.1.16907 WP_003687106.1.19309 WP_003687106.1.21563 WP_003687106.1.24180 WP_003687106.1.28664 WP_003687106.1.30002 WP_003687106.1.33375 WP_003687106.1.3414 WP_003687106.1.39077 WP_003687106.1.46428 WP_003687106.1.48369 WP_003687106.1.54378 WP_003687106.1.58285 WP_003687106.1.60906 WP_003687106.1.74664 WP_003687106.1.80312 WP_003687106.1.82560 WP_003687106.1.83346 WP_003687106.1.85137 WP_003687106.1.85925 WP_003687106.1.91463 YP_209130.1.29278 gi|59802418|ref|YP_209130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]