SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 378092 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  378092
Domain Number 1 Region: 10-146
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.44e-27
Family MarR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 378092
Sequence length 151
Comment $ JCSG $ SQ130922 $ PDBT34504 $
Sequence
MDKSTQAASRLLAFRFLSTSQLLYRSLELMMGRELGLSVRQWRVMFFLANDGVGSVQEIA
DFCRYDKSQVSRALQELTDKAYVNRVPGVHDRRKVLASLTPAGIEVYRQGLRISLARDER
MKRALSADELAAFNATLDKLAEQAQAIMDEL
Download sequence
Identical sequences A0A063UHL9 A0A0C6PD36 A0A0H3LQI3 A0A1M9GTT5 A0A2J9U652 K0MJT8 Q7W470
WP_003814663.1.14246 WP_003814663.1.15674 WP_003814663.1.1660 WP_003814663.1.17334 WP_003814663.1.17359 WP_003814663.1.19828 WP_003814663.1.20111 WP_003814663.1.21837 WP_003814663.1.23657 WP_003814663.1.24339 WP_003814663.1.26498 WP_003814663.1.27032 WP_003814663.1.29688 WP_003814663.1.30681 WP_003814663.1.32589 WP_003814663.1.37794 WP_003814663.1.38534 WP_003814663.1.40806 WP_003814663.1.50287 WP_003814663.1.54628 WP_003814663.1.57255 WP_003814663.1.58338 WP_003814663.1.63299 WP_003814663.1.63717 WP_003814663.1.64622 WP_003814663.1.66177 WP_003814663.1.69310 WP_003814663.1.71104 WP_003814663.1.71382 WP_003814663.1.71489 WP_003814663.1.72041 WP_003814663.1.72199 WP_003814663.1.72302 WP_003814663.1.78117 WP_003814663.1.82663 WP_003814663.1.84958 WP_003814663.1.84976 WP_003814663.1.86585 WP_003814663.1.87218 WP_003814663.1.88542 WP_003814663.1.91389 WP_003814663.1.93987 YP_006897608.1.34978 YP_006970206.1.84680 gi|410474327|ref|YP_006897608.1| gi|33598308|ref|NP_885951.1| gi|412341451|ref|YP_006970206.1| gi|33603219|ref|NP_890779.1| 378092 APC88985 257310.BB4244 257311.BPP3799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]