SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 378130 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  378130
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.62e-23
Family MarR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 378130
Sequence length 145
Comment $ JCSG $ SQ132529 $ PDBT34536 $
Sequence
MKASPAGRLFTEIVLEVFKLSGQLTTEGDKLTQDVQMSSARWKVLGALGRAGNPMTVSDV
AHSMGQSRQGVQRLANEMVELGFIALADNPQHKKAKLLLLTDKGVDVLQQLEQKQLPWAE
ACAQGIDAEALQVTLDTLRKLERKL
Download sequence
Identical sequences A3QHR6
gi|127514076|ref|YP_001095273.1| WP_011866944.1.33760 323850.Shew_3148 378130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]