SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 378222 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  378222
Domain Number - Region: 49-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00271
Family Sfri0576-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 378222
Sequence length 123
Comment $ JCSG $ SQ130944 $ PDBT34611 $
Sequence
MSGDSEVGTEAGLTLGGDGILRLTWPRGAAITAADAERAMLRVNQLCGDDRHPMLVDMAT
TADVSRGARAVFGRPCQASRIALLGSSPVDRVLANFFLGINAVPCPTKFFTSERDALTWL
ALT
Download sequence
Identical sequences A0JR48
WP_011689988.1.37281 gi|116668685|ref|YP_829618.1| 378222 290399.Arth_0117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]