SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 378225 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  378225
Domain Number - Region: 35-121
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0302
Family Sfri0576-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 378225
Sequence length 122
Comment $ JCSG $ SQ131206 $ PDBT34613 $
Sequence
MSSSYKDENVELFFKDAILFGIYQPPVVTLDVAQKAVKQRLTFSEGKTYRVLIDIRRIKS
VTAEARKFLAEPYCFDGISIAAIVVNNIFQETIGNIYIYLSKHPVPLKLFRSEKDAMNWL
KE
Download sequence
Identical sequences Q11UH0
378225 269798.CHU_1676 gi|110638077|ref|YP_678286.1| WP_011585061.1.19587 WP_011585061.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]