SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 378240 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  378240
Domain Number - Region: 46-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0557
Family Sfri0576-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 378240
Sequence length 119
Comment $ JCSG $ SQ130946 $ PDBT34627 $
Sequence
MSKPLGLMQEQIVRIVLPRDEHLDEQSAQLLAAGLQAPQWGSPLAVLMDVTDVASVSRAA
RAVFSNVSTVAAWALLGRTPVDRILAHFILGGDFKSGPASYFTSETDALKWLKETTHVH
Download sequence
Identical sequences A0JR45
gi|116668682|ref|YP_829615.1| 378240 290399.Arth_0114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]