SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 378252 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  378252
Domain Number 1 Region: 9-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000765
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 378252
Sequence length 114
Comment $ JCSG $ SQ135342 $ PDBT34634 $
Sequence
MDLISGENYHVRYDPTRSLVAISGILRLNGMSEYEPITAVLRQALAQNEILTIDLTELEF
LNSSGIAMLSKFVIEARAHEGGSLTVLGSTAVAWQGKSLVNLKRLLPTLKLDFQ
Download sequence
Identical sequences Q2RY90
WP_011387861.1.3410 YP_425192.1.57063 gi|386348121|ref|YP_006046369.1| gi|83591440|ref|YP_425192.1| 378252 269796.Rru_A0100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]