SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 378314 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  378314
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000922
Family Anti-sigma factor antagonist SpoIIaa 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 378314
Sequence length 95
Comment $ JCSG $ SQ131221 $ PDBT34689 $
Sequence
MVAAISLPENLDLKTAAPLKAAFLERRGAEIIVEADQVRRLGGLCLQVLLAARKAWEQDG
HPFSIKGPSEAFVETTRLFGAAGALLPTEFQGAES
Download sequence
Identical sequences A0A0H3C3R0 Q9AB04
190650.CC_0431 378314 gi|16124686|ref|NP_419250.1| NP_419250.1.61804 YP_002515815.2.80956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]