SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 378790 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  378790
Domain Number 1 Region: 3-36,68-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.07e-49
Family PAPS sulfotransferase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 378790
Sequence length 280
Comment $ JCSG $ SQ136068 $ PDBT35012 $
Sequence
MGNILWVASYPKSGNTWVRAFLENYIQNQAQPIDINTMHTISTAESAAHRYQHYLPKDKT
ATTELTLEEVSVLRPQVQADIAHQANGTTFVKTHNYLGEYNGHPLHNSSVTSGAIYVVRN
PLDVAISMANYFGYSIDEAIAYMAEEMTGTPNEAPHVPQIITSWSMHVSSWTADDASKLI
LRYEDMLDDPKKVFRKVESFLGLKKDPVRLKNAIKHSSFAQLKAQETKLGFVEKHENANA
FFRNGGKHQWKTKLTPEQVQKIVATHYEQMKRFKYLPAGM
Download sequence
Identical sequences Q087C1
WP_011636267.1.15765 gi|114561969|ref|YP_749482.1| 318167.Sfri_0789 378790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]