SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 378819 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  378819
Domain Number 1 Region: 1-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-51
Family Nitrogenase iron protein-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 378819
Sequence length 249
Comment $ JCSG $ SQ135544 $ PDBT35032 $
Sequence
MQIVACYSNKGGVGKTATAVNLAYAFATSGRRTLLCDLDPQGASGFYFRVKPSKKLTEAR
FFEDVEHFTKSIRGSDYDNLDILPANMSFRDFDVFLSKMKDARSRLKKALKAVKGDYDIV
LLDCPPNISILSENIFRAADAVVTPVIPTTLSQRTFEQLLEFFREHDLPMEKIHAFFSMI
QGTKTLHGEMIVELTHNYPKRIMAAKIPFASEIERMGVVRAPVLATAPDSPAGKAYQALF
DELLERIVP
Download sequence
Identical sequences A0A1H9Z1T3 Q82UJ0
378819 228410.NE1495 gi|30249466|ref|NP_841536.1| WP_011112063.1.11244 WP_011112063.1.14462 WP_011112063.1.55826 WP_011112063.1.61914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]