SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 379881 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  379881
Domain Number 1 Region: 22-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0024
Further Details:      
 
Domain Number 2 Region: 171-230
Classification Level Classification E-value
Superfamily CheY-like 0.00000696
Family CheY-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 379881
Sequence length 261
Comment $ JCSG $ SQ138991 $ PDBT35784 $
Sequence
MSEQELSQLSGGMDDAAPCPWLKVEVHPAGDRQVVVAYGDIDVDTEAILQRALREALDHS
VSGVNLDLGAVGFCDCAGLNVLLRMRRHALAHGKTLAVQATGPATGKLLTITGTLSLFDV
TAGPGTRAKGRNPLPPEPHDPSRVDHIDGTGRGRDGTDLETDGTIDGTVVDLRIEVGQLR
RAMQTRPVIDLARGVLMASFGLSAEDAWTVLVTVSQHTNTKLHQIAEDLVNTVQGAPLPE
PLQRQLAEAVMPFSRVRNAGA
Download sequence
Identical sequences Q82LF2
gi|29828600|ref|NP_823234.1| 379881 227882.SAV_2058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]