SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383909 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383909
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.36e-29
Family Sfri0576-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 383909
Sequence length 114
Comment $ JCSG $ SQ101584 $ PDBT38547 $
Sequence
MINIEETGNLIVVAVIGEFTLDDFRQFEDQVLYQFHFNGEANLLLDLRDMVSYSVDVAWK
EIRFMREHGSKINRVAVVTDSQWQVWSAWVSNLFTDADVVVFSDYDEAYGWARI
Download sequence
Identical sequences A0A1H9Z2D1 Q82UI4
gi|30249472|ref|NP_841542.1| 383909 APC7047 228410.NE1501 WP_011112069.1.11244 WP_011112069.1.14462 WP_011112069.1.55826 WP_011112069.1.61914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]