SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386086 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  386086
Domain Number - Region: 4-12,41-93
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.00641
Family Typo IV secretion system protein TraC 0.017
Further Details:      
 
Domain Number - Region: 82-171
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0131
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 386086
Sequence length 188
Comment $ JCSG $ SQ236204 $ PDBT38851 $
Sequence
QWVVTDPGNLAQSIINMSDNIAHTSKTAVNTADNFAETVKIYEQAKKYYDQLKAVNNLIQ
DARKVRDIILMVGDVSDIYVTNFKKMMNDDNFSSRELDAIAFGYTRLLEESNDVLQDLKQ
VINVSTLSMTDKDRMDVVDNCYYEMRRYRNLVSYYTNKNIAVSYLRARKKNDMERVMRLY
GNETSKYW
Download sequence
Identical sequences 386086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]