SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 388770 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  388770
Domain Number 1 Region: 61-161
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.00000602
Family Hypothetical protein TM0269 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 388770
Sequence length 213
Comment $ JCSG $ SQ148282 $ PDBT39903 $
Sequence
MKRKITPELSSKDWKEFCSRFHFDNDKLPLIRAIYTAMLPLVDAFAYYSIKQDLPGVSLA
HYAYGLVTLGNGVDELSELYLNHEQLEEAYIADCLSLMLLSNAYEQFAKAVEEESSLYAI
ELSFLGDEYPLELLPEIFEHVSPDGIHLTGSNMLKPLKTAALIIKLDSQKRKNIKELCNT
CANCKNLSCPSRKAPGPKLPHTYGAMQIFNIRH
Download sequence
Identical sequences A0A173SCU0 A0A1Q6PKC3 C4ZD39 D6E630
gi|238924620|ref|YP_002938136.1| WP_012743097.1.21182 WP_012743097.1.32465 515619.EUBREC_2263 388770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]