SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 392906 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392906
Domain Number 1 Region: 41-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000216
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 392906
Sequence length 118
Comment $ JCSG $ SQ171942 $ PDBT42815 $
Sequence
MRRSQAMEIKTDDYRVWIEGSDIFFDGVMRLASSEAGAPIMALATSALASNPSSMTLNLK
DLHFLNSSGINLLAKFTIEVRKHPDVRFVVRGTPDIPWQSKSLPNLKKLHPALVLLMD
Download sequence
Identical sequences Q988K6
gi|13475591|ref|NP_107155.1| 266835.mll6698 392906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]