SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 396932 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  396932
Domain Number 1 Region: 14-209
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.85e-22
Family Extended AAA-ATPase domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 396932
Sequence length 231
Comment $ JCSG $ SQ186434 $ PDBT44614 $
Sequence
PLQLSLPVHLPDDETFTSYYPAAGNDELIGALKSAASGDGVQAIYLWGPVKSGRTHLIHA
ACARANELERRSFYIPLGIHASISTALLEGLEQFDLICIDDVDAVAGHPLWEEAIFDLYN
RVAEQKRGSLIVSASASPMEAGFVLPDLVSRMHWGLTYQLQPMMDDEKLAALQRRAAMRG
LQLPEDVGRFLLNRMARDLRTLFDVLDRLDKASMVHQRKLTIPFVKEMLRL
Download sequence
Identical sequences 396932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]