SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 400497 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400497
Domain Number 1 Region: 262-294,369-443
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 400497
Sequence length 478
Comment $ JCSG $ SQ200497 $ PDBT46975 $
Sequence
MVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLL
PPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGS
LFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIV
NLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSP
SYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPAL
IMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFP
EELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVND
LTRNNFFENPALKELLFHSIHDAVLGSQVREAMAEQEATASLPQEDMEPNATPTTPEA
Download sequence
Identical sequences Q32MT7
NP_001276717.1.92730 400497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]