SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 401485 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  401485
Domain Number 1 Region: 47-190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-24
Family Extended AAA-ATPase domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 401485
Sequence length 297
Comment $ JCSG $ SQ215016 $ PDBT47395 $
Sequence
MLTMKPEFVAQLERVLSSVEMLLPRAVKPVNWSTCYAANWRRHSFSGFLQAVRVTDTTSL
HELLGVEKQKEIMISNTRQFLKGLPANNALLWGSRGTGKSSLVKALLNEYACEGLRVIQV
EKEDLIYLSDIFSAVEGEPYRFILLCDDLTFEPGELTYKILKSALDGSVYSPPENVLIYV
TSNRRHLLPEYESDNIGWKLVNGELQESEATEEKIALSDRFGLWVPFHVFTQDRYLEAVR
LCVEREARTREVDIPWSEQLRLDAIQWSHDKKKRCGRTAYQFSKHWVGKYLLARQAA
Download sequence
Identical sequences Q39SI4
WP_004513463.1.25803 WP_004513463.1.48315 401485 269799.Gmet_2571 gi|404497422|ref|YP_006721528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]