SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402597 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402597
Domain Number 1 Region: 204-253
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000363
Family AraC type transcriptional activator 0.023
Further Details:      
 
Weak hits

Sequence:  402597
Domain Number - Region: 157-201
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000184
Family AraC type transcriptional activator 0.071
Further Details:      
 
Domain Number - Region: 97-181
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000916
Family DBL homology domain (DH-domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 402597
Sequence length 262
Comment $ JCSG $ SQ217305 $ PDBT47975 $
Sequence
MPLDTAKIDHASRYNSAHRIEMPAIRLIISRSKGEITIQEDTYAFPEHCLIVTNNKARIS
TDSHPNAMLSLDFLASDLQRLLPEVVELLEADNQKTFKKEAVKIVKTDCNATEVLASLSQ
LAPSSFLYFAYLYCLNLDRAYFSALLRSCIAGNKDFYEFIEKNALQQWSISTLADRFGMP
LRKFNQLFQEAYGKPAKRWILEHRLTHAKKLLLTTSMRVLDVALECGFSNHAHFTDSFRR
HFQCNPKQFRQQALGKLRDKET
Download sequence
Identical sequences Q7NUW3
402597 gi|34498039|ref|NP_902254.1| 243365.CV_2584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]