SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 403230 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  403230
Domain Number 1 Region: 89-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-23
Family Phosphate binding protein-like 0.0041
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.35e-18
Family LysR-like transcriptional regulators 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 403230
Sequence length 293
Comment $ JCSG $ SQ216006 $ PDBT48503 $
Sequence
MKTSQIKIFLSVVRNGSVAAAARELNRSRTTVSTMLASLEDELGVELFERSGNQLHLTAI
GQSILTDCRRFDQVAGQIQARCQHHLSGAESVLRIARDDAIPEDIWRDILRRLKQRFPQT
SISVYLASPRELPPLVRNQSVDVAYGLMPELLNEGYQWFRELADVRMLTVAAPDHPLSQL
KRVTQDDLISHTEITLAYMLDAQLVAESPETANYLAFTQYELMRDAVIDGAGWADLPLPL
IAEALRKEQLKTIHHRSARWWKVFSALESEQAQGGAVVGWLANELEAYLETLG
Download sequence
Identical sequences A1TXH2
351348.Maqu_0336 WP_011783889.1.7233 403230 gi|120553277|ref|YP_957628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]