SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 403269 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  403269
Domain Number 1 Region: 75-252
Classification Level Classification E-value
Superfamily GAF domain-like 2.22e-30
Family IclR ligand-binding domain-like 0.0069
Further Details:      
 
Domain Number 2 Region: 12-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000602
Family Transcriptional regulator IclR, N-terminal domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 403269
Sequence length 254
Comment $ JCSG $ SQ130169 $ PDBT48536 $
Sequence
MTEDLIKRRARGLDRAFDILDFLKEKARPMRPNEIASGIGSPKSTVYELVASLLERRILE
SVGKDGHVYLGRQLYFLGQAHLRHFDLTREAEACLGDIVSQTRETAQMCLLNGRKYTVAL
MKEGERHFRISSDIGENAPIPWTASGRLLLSHLTDQQIVDLIDPDEFILPGGERLPLETF
LREIRTAGEEGFFSFDSVADTFTHCFAAPVKNEQGQCIATLCIVAPRADAKTHYNDYRRV
LIDSANGLARRINE
Download sequence
Identical sequences A0A0Q0BRS8 F3IBL9 Q881V2
gi|28869966|ref|NP_792585.1| NP_792585.1.37326 WP_005762474.1.12126 WP_005762474.1.14276 WP_005762474.1.17870 WP_005762474.1.6959 WP_005762474.1.80269 403269 APC87810 223283.PSPTO_2780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]