SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 417906 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  417906
Domain Number - Region: 78-171
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00145
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 417906
Sequence length 188
Comment $ JCSG $ SQ234800 $ PDBT51039 $
Sequence
QWVVTDPGNLAQGIINSAKQIIQTSTTANNTLNGFKETAKVFEQGKKYYDALKSVHNLVK
DARKVQQTVLLVGDISEMYVTNYQKMLSDPNFTPGELNAIAFGYTKLLEESSGLLEELKT
VVNANGLSMSDKERMDVIDRVYRDVKDYRNLVAYYTNRNISVSYLRAKEKNDTKRILSLY
GSANERYW
Download sequence
Identical sequences 417906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]