SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAB17536 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAB17536
Domain Number 1 Region: 96-165
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.63e-23
Family Skp1 dimerisation domain-like 0.00022
Further Details:      
 
Domain Number 2 Region: 15-82
Classification Level Classification E-value
Superfamily POZ domain 6.28e-19
Family BTB/POZ domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AAB17536
Sequence length 172
Comment $ SECSG $ SQ28355 $ PDBT2751 $
Sequence
MSAPIVDAPAAEIVYKIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPV
TNVNGKTMAKVAEWCEKHKADAIPEDNMNVLKTLTIPEWDQKFLKIEDEALFDLILASNF
LDIKGLMYFGCKTVSNMAKGKTTAELREIFGINTDEQDAAEETAQRAAAEVA
Download sequence
Identical sequences G5EGD5
C52D10.6.1 C52D10.6.2 AAB17536 WR8 C52D10.6 C52D10.6.1 NP_503045.1.50509 6239.C52D10.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]