SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC20234 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC20234
Domain Number 1 Region: 237-279
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000112
Family AraC type transcriptional activator 0.033
Further Details:      
 
Weak hits

Sequence:  APC20234
Domain Number - Region: 33-121
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0305
Family DBL homology domain (DH-domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC20234
Sequence length 284
Comment $ MCSG $ SQ139536 $ PDBT59766 $
Sequence
MKTDRLLADTKTIRYEETDLASLISAPYHFRCGIYLICTQGEAVVSTGVQKYIFNEQTEL
IFLTGGLLQVLETSGDLQVKMLMFPKEAFLNAMLPIDTPYFNYTHEHPCYHHTADERSQK
TWRQINLWMDMAQMLFTEPMPQFRGQQEHNFLQSLLMWLFNTIPEKLAVSKQYSRTQLLC
HRFMQLIREYSMHEHQVAFYAEKLCISSRYLHKITVRHLDGKKPKQLIDEQLVAEIKVLL
NEPRLSVTEIAEQLHFPDQSYLTHFFKKNTGISPKEFRAIKNLG
Download sequence
Identical sequences A0A015S8N8 A0A015SZB6 A0A015VA34 A0A015VJR5 A0A015VTP1 A0A015X804 A0A015XLT2 A0A015YQS0 A0A016EJQ1 A0A016EK09 A0A016F502 A0A016G603 A0A017P8J0 A0A0E2AFV8 A0A0E2AU39 A0A0E2TCU9 A0A0E2TGY9 A0A0M4BTU6 A0A139TCE0 A0A149NGV3 D1JRZ2 F7LKY1 Q5LHE7 R6Z1H8
gi|60680247|ref|YP_210391.1| WP_005784835.1.10405 WP_005784835.1.11335 WP_005784835.1.15557 WP_005784835.1.18542 WP_005784835.1.2011 WP_005784835.1.21713 WP_005784835.1.21908 WP_005784835.1.22050 WP_005784835.1.23698 WP_005784835.1.26260 WP_005784835.1.26832 WP_005784835.1.30158 WP_005784835.1.30608 WP_005784835.1.31541 WP_005784835.1.32651 WP_005784835.1.34692 WP_005784835.1.35533 WP_005784835.1.35582 WP_005784835.1.35818 WP_005784835.1.36984 WP_005784835.1.37052 WP_005784835.1.37988 WP_005784835.1.38746 WP_005784835.1.39779 WP_005784835.1.40326 WP_005784835.1.40404 WP_005784835.1.4066 WP_005784835.1.42362 WP_005784835.1.43770 WP_005784835.1.456 WP_005784835.1.48703 WP_005784835.1.49420 WP_005784835.1.49748 WP_005784835.1.50935 WP_005784835.1.51373 WP_005784835.1.5142 WP_005784835.1.51489 WP_005784835.1.51763 WP_005784835.1.52936 WP_005784835.1.53885 WP_005784835.1.53910 WP_005784835.1.54019 WP_005784835.1.55270 WP_005784835.1.56204 WP_005784835.1.57121 WP_005784835.1.58084 WP_005784835.1.60699 WP_005784835.1.60854 WP_005784835.1.6251 WP_005784835.1.63590 WP_005784835.1.65409 WP_005784835.1.65726 WP_005784835.1.65921 WP_005784835.1.66858 WP_005784835.1.66941 WP_005784835.1.69826 WP_005784835.1.73957 WP_005784835.1.75176 WP_005784835.1.75668 WP_005784835.1.7580 WP_005784835.1.77492 WP_005784835.1.78347 WP_005784835.1.81678 WP_005784835.1.85293 WP_005784835.1.89424 WP_005784835.1.89819 WP_005784835.1.91045 WP_005784835.1.91849 WP_005784835.1.93484 WP_005784835.1.93759 WP_005784835.1.9461 WP_005784835.1.95091 WP_005784835.1.95195 WP_005784835.1.95750 WP_005784835.1.97365 WP_005784835.1.97964 WP_005784835.1.98903 WP_005784835.1.9932 272559.BF0688 APC20234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]