SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC22985 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC22985
Domain Number - Region: 169-233
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000194
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.02
Further Details:      
 
Domain Number - Region: 77-151
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00294
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC22985
Sequence length 240
Comment $ MCSG $ SQ16918 $ PDBT62190 $
Sequence
MRSVPRRERHRRLRNAKDCACRYHSPTPQIFDRLELLNQQLNYALPVGIISQAIITTDNY
LGYSLSHYLFSGKRTAAFRSLDDISLWIEKGSLRQLIVDMEALPVSCIEALNQLRALSWQ
QSDIQIYLLVSDKTSAITQFIRMAGRFFVLSRRQNLASVREALLSASKPRLSESFSRTDW
LMIETLAQGASLKEIARQQSVPYHRVVYRLKQLITLLNLPHRQSFLRLIQQLNVTFHDIF
Download sequence
Identical sequences A0A0D6H7G5 A0A0F6AY37 A0A0F7J6Q2 A0A0H3N8P3 A0A0U1FHW7 A0A0W3QZY8 A0A2D3AM41 A0A2H9YMR4 E8X925 P26318
gi|378987952|ref|YP_005251116.1| gi|550899988|ref|YP_008669080.1| APC22985 gi|526219433|ref|YP_008264802.1| NP_459545.1.58477 WP_001258122.1.100010 WP_001258122.1.100234 WP_001258122.1.100376 WP_001258122.1.100424 WP_001258122.1.100436 WP_001258122.1.100484 WP_001258122.1.100488 WP_001258122.1.100597 WP_001258122.1.10076 WP_001258122.1.100781 WP_001258122.1.100793 WP_001258122.1.100869 WP_001258122.1.100871 WP_001258122.1.100882 WP_001258122.1.101007 WP_001258122.1.101020 WP_001258122.1.101074 WP_001258122.1.101078 WP_001258122.1.101180 WP_001258122.1.101259 WP_001258122.1.101284 WP_001258122.1.101291 WP_001258122.1.101386 WP_001258122.1.101404 WP_001258122.1.101420 WP_001258122.1.101589 WP_001258122.1.101707 WP_001258122.1.101734 WP_001258122.1.101878 WP_001258122.1.101953 WP_001258122.1.10220 WP_001258122.1.10266 WP_001258122.1.10429 WP_001258122.1.10439 WP_001258122.1.10678 WP_001258122.1.10753 WP_001258122.1.10992 WP_001258122.1.11024 WP_001258122.1.11031 WP_001258122.1.11098 WP_001258122.1.11168 WP_001258122.1.11190 WP_001258122.1.11295 WP_001258122.1.11455 WP_001258122.1.11458 WP_001258122.1.11518 WP_001258122.1.11532 WP_001258122.1.11543 WP_001258122.1.11763 WP_001258122.1.11772 WP_001258122.1.11897 WP_001258122.1.12114 WP_001258122.1.12351 WP_001258122.1.12370 WP_001258122.1.12546 WP_001258122.1.1264 WP_001258122.1.12728 WP_001258122.1.12879 WP_001258122.1.12936 WP_001258122.1.12995 WP_001258122.1.13027 WP_001258122.1.13106 WP_001258122.1.13130 WP_001258122.1.13414 WP_001258122.1.13488 WP_001258122.1.13509 WP_001258122.1.13669 WP_001258122.1.13741 WP_001258122.1.1387 WP_001258122.1.13908 WP_001258122.1.13932 WP_001258122.1.13968 WP_001258122.1.14001 WP_001258122.1.14151 WP_001258122.1.14239 WP_001258122.1.14320 WP_001258122.1.14379 WP_001258122.1.14406 WP_001258122.1.14410 WP_001258122.1.14466 WP_001258122.1.14524 WP_001258122.1.14554 WP_001258122.1.14725 WP_001258122.1.14852 WP_001258122.1.1489 WP_001258122.1.14932 WP_001258122.1.15055 WP_001258122.1.15124 WP_001258122.1.15223 WP_001258122.1.15226 WP_001258122.1.15316 WP_001258122.1.15369 WP_001258122.1.1540 WP_001258122.1.15508 WP_001258122.1.15784 WP_001258122.1.15830 WP_001258122.1.16062 WP_001258122.1.16063 WP_001258122.1.16103 WP_001258122.1.16226 WP_001258122.1.16233 WP_001258122.1.16284 WP_001258122.1.16328 WP_001258122.1.1635 WP_001258122.1.16468 WP_001258122.1.16614 WP_001258122.1.16650 WP_001258122.1.16686 WP_001258122.1.16691 WP_001258122.1.16732 WP_001258122.1.16735 WP_001258122.1.16786 WP_001258122.1.16858 WP_001258122.1.16896 WP_001258122.1.16965 WP_001258122.1.1700 WP_001258122.1.17307 WP_001258122.1.174 WP_001258122.1.17480 WP_001258122.1.17546 WP_001258122.1.17702 WP_001258122.1.17705 WP_001258122.1.18019 WP_001258122.1.18111 WP_001258122.1.18163 WP_001258122.1.18265 WP_001258122.1.18267 WP_001258122.1.18468 WP_001258122.1.18607 WP_001258122.1.18705 WP_001258122.1.18715 WP_001258122.1.18776 WP_001258122.1.18822 WP_001258122.1.18881 WP_001258122.1.18940 WP_001258122.1.18949 WP_001258122.1.19053 WP_001258122.1.19320 WP_001258122.1.19458 WP_001258122.1.19460 WP_001258122.1.19461 WP_001258122.1.19614 WP_001258122.1.19702 WP_001258122.1.19706 WP_001258122.1.19724 WP_001258122.1.19749 WP_001258122.1.19784 WP_001258122.1.19802 WP_001258122.1.19809 WP_001258122.1.19867 WP_001258122.1.1998 WP_001258122.1.20 WP_001258122.1.20212 WP_001258122.1.20266 WP_001258122.1.20271 WP_001258122.1.20362 WP_001258122.1.20418 WP_001258122.1.20443 WP_001258122.1.20525 WP_001258122.1.2054 WP_001258122.1.20553 WP_001258122.1.20626 WP_001258122.1.20646 WP_001258122.1.20886 WP_001258122.1.20908 WP_001258122.1.21049 WP_001258122.1.21146 WP_001258122.1.21245 WP_001258122.1.21246 WP_001258122.1.21269 WP_001258122.1.21400 WP_001258122.1.21497 WP_001258122.1.21499 WP_001258122.1.21603 WP_001258122.1.21751 WP_001258122.1.21757 WP_001258122.1.22024 WP_001258122.1.2205 WP_001258122.1.22062 WP_001258122.1.22067 WP_001258122.1.2221 WP_001258122.1.2235 WP_001258122.1.22379 WP_001258122.1.22427 WP_001258122.1.2246 WP_001258122.1.22485 WP_001258122.1.22620 WP_001258122.1.22870 WP_001258122.1.22979 WP_001258122.1.23102 WP_001258122.1.2314 WP_001258122.1.23192 WP_001258122.1.23259 WP_001258122.1.23460 WP_001258122.1.23472 WP_001258122.1.23482 WP_001258122.1.23634 WP_001258122.1.2364 WP_001258122.1.23932 WP_001258122.1.24017 WP_001258122.1.24206 WP_001258122.1.24308 WP_001258122.1.24578 WP_001258122.1.24737 WP_001258122.1.24779 WP_001258122.1.25008 WP_001258122.1.25015 WP_001258122.1.25405 WP_001258122.1.25454 WP_001258122.1.25493 WP_001258122.1.25668 WP_001258122.1.25690 WP_001258122.1.2570 WP_001258122.1.25740 WP_001258122.1.25793 WP_001258122.1.25814 WP_001258122.1.25988 WP_001258122.1.26282 WP_001258122.1.26311 WP_001258122.1.26319 WP_001258122.1.26429 WP_001258122.1.26440 WP_001258122.1.26493 WP_001258122.1.26551 WP_001258122.1.26567 WP_001258122.1.27010 WP_001258122.1.27173 WP_001258122.1.27206 WP_001258122.1.27423 WP_001258122.1.27561 WP_001258122.1.2763 WP_001258122.1.27665 WP_001258122.1.27707 WP_001258122.1.27761 WP_001258122.1.2777 WP_001258122.1.27857 WP_001258122.1.27977 WP_001258122.1.28094 WP_001258122.1.28170 WP_001258122.1.28302 WP_001258122.1.2835 WP_001258122.1.28370 WP_001258122.1.28538 WP_001258122.1.28575 WP_001258122.1.28625 WP_001258122.1.28655 WP_001258122.1.28694 WP_001258122.1.2879 WP_001258122.1.2890 WP_001258122.1.28938 WP_001258122.1.28946 WP_001258122.1.29006 WP_001258122.1.29010 WP_001258122.1.2910 WP_001258122.1.29588 WP_001258122.1.29601 WP_001258122.1.29606 WP_001258122.1.29615 WP_001258122.1.29619 WP_001258122.1.29704 WP_001258122.1.29969 WP_001258122.1.30006 WP_001258122.1.30027 WP_001258122.1.30180 WP_001258122.1.30469 WP_001258122.1.30505 WP_001258122.1.30507 WP_001258122.1.30535 WP_001258122.1.30547 WP_001258122.1.30794 WP_001258122.1.30833 WP_001258122.1.30835 WP_001258122.1.30972 WP_001258122.1.31 WP_001258122.1.3113 WP_001258122.1.31185 WP_001258122.1.3119 WP_001258122.1.31190 WP_001258122.1.31195 WP_001258122.1.31196 WP_001258122.1.31281 WP_001258122.1.31362 WP_001258122.1.31504 WP_001258122.1.31515 WP_001258122.1.31578 WP_001258122.1.31658 WP_001258122.1.31940 WP_001258122.1.31967 WP_001258122.1.31972 WP_001258122.1.32192 WP_001258122.1.32206 WP_001258122.1.32438 WP_001258122.1.32515 WP_001258122.1.32660 WP_001258122.1.32702 WP_001258122.1.32714 WP_001258122.1.32786 WP_001258122.1.32804 WP_001258122.1.32907 WP_001258122.1.33030 WP_001258122.1.33127 WP_001258122.1.33143 WP_001258122.1.33248 WP_001258122.1.33261 WP_001258122.1.333 WP_001258122.1.33492 WP_001258122.1.33553 WP_001258122.1.33592 WP_001258122.1.33894 WP_001258122.1.34043 WP_001258122.1.34075 WP_001258122.1.34257 WP_001258122.1.34279 WP_001258122.1.34319 WP_001258122.1.34453 WP_001258122.1.34610 WP_001258122.1.34856 WP_001258122.1.34975 WP_001258122.1.35045 WP_001258122.1.35129 WP_001258122.1.35184 WP_001258122.1.35404 WP_001258122.1.35408 WP_001258122.1.35425 WP_001258122.1.35446 WP_001258122.1.35463 WP_001258122.1.35503 WP_001258122.1.35509 WP_001258122.1.35590 WP_001258122.1.35940 WP_001258122.1.36003 WP_001258122.1.3601 WP_001258122.1.36609 WP_001258122.1.36690 WP_001258122.1.3670 WP_001258122.1.36918 WP_001258122.1.36931 WP_001258122.1.37073 WP_001258122.1.37111 WP_001258122.1.37112 WP_001258122.1.37256 WP_001258122.1.37293 WP_001258122.1.37370 WP_001258122.1.37376 WP_001258122.1.3744 WP_001258122.1.37498 WP_001258122.1.37504 WP_001258122.1.37618 WP_001258122.1.37968 WP_001258122.1.37978 WP_001258122.1.38125 WP_001258122.1.38145 WP_001258122.1.383 WP_001258122.1.3848 WP_001258122.1.38613 WP_001258122.1.38673 WP_001258122.1.38693 WP_001258122.1.38773 WP_001258122.1.38882 WP_001258122.1.38913 WP_001258122.1.39003 WP_001258122.1.39136 WP_001258122.1.39197 WP_001258122.1.39229 WP_001258122.1.39405 WP_001258122.1.39420 WP_001258122.1.39449 WP_001258122.1.39512 WP_001258122.1.39629 WP_001258122.1.39763 WP_001258122.1.39862 WP_001258122.1.39921 WP_001258122.1.39923 WP_001258122.1.40017 WP_001258122.1.40072 WP_001258122.1.40073 WP_001258122.1.4011 WP_001258122.1.40208 WP_001258122.1.40240 WP_001258122.1.40257 WP_001258122.1.40292 WP_001258122.1.40305 WP_001258122.1.40311 WP_001258122.1.40380 WP_001258122.1.40395 WP_001258122.1.40465 WP_001258122.1.40710 WP_001258122.1.4075 WP_001258122.1.4087 WP_001258122.1.40877 WP_001258122.1.41017 WP_001258122.1.41086 WP_001258122.1.41091 WP_001258122.1.41226 WP_001258122.1.41279 WP_001258122.1.41516 WP_001258122.1.41554 WP_001258122.1.41572 WP_001258122.1.41591 WP_001258122.1.41662 WP_001258122.1.41708 WP_001258122.1.41761 WP_001258122.1.41882 WP_001258122.1.41979 WP_001258122.1.41985 WP_001258122.1.42104 WP_001258122.1.42320 WP_001258122.1.42342 WP_001258122.1.42422 WP_001258122.1.4276 WP_001258122.1.42864 WP_001258122.1.4288 WP_001258122.1.43018 WP_001258122.1.43041 WP_001258122.1.43244 WP_001258122.1.43312 WP_001258122.1.43334 WP_001258122.1.43437 WP_001258122.1.43522 WP_001258122.1.43613 WP_001258122.1.43668 WP_001258122.1.43886 WP_001258122.1.44005 WP_001258122.1.44043 WP_001258122.1.44099 WP_001258122.1.44121 WP_001258122.1.44291 WP_001258122.1.44310 WP_001258122.1.44386 WP_001258122.1.44479 WP_001258122.1.44640 WP_001258122.1.4467 WP_001258122.1.44747 WP_001258122.1.4485 WP_001258122.1.44877 WP_001258122.1.44927 WP_001258122.1.45067 WP_001258122.1.45074 WP_001258122.1.45079 WP_001258122.1.45098 WP_001258122.1.45177 WP_001258122.1.45184 WP_001258122.1.45259 WP_001258122.1.45349 WP_001258122.1.45365 WP_001258122.1.45550 WP_001258122.1.45585 WP_001258122.1.45660 WP_001258122.1.45690 WP_001258122.1.458 WP_001258122.1.46011 WP_001258122.1.46069 WP_001258122.1.46112 WP_001258122.1.46173 WP_001258122.1.46174 WP_001258122.1.46187 WP_001258122.1.46303 WP_001258122.1.46595 WP_001258122.1.46675 WP_001258122.1.47057 WP_001258122.1.47214 WP_001258122.1.47429 WP_001258122.1.47448 WP_001258122.1.4747 WP_001258122.1.47472 WP_001258122.1.47478 WP_001258122.1.47621 WP_001258122.1.47799 WP_001258122.1.48242 WP_001258122.1.48253 WP_001258122.1.483 WP_001258122.1.48367 WP_001258122.1.48377 WP_001258122.1.4853 WP_001258122.1.48788 WP_001258122.1.4885 WP_001258122.1.48894 WP_001258122.1.48919 WP_001258122.1.49084 WP_001258122.1.49155 WP_001258122.1.49204 WP_001258122.1.49239 WP_001258122.1.49256 WP_001258122.1.49290 WP_001258122.1.49340 WP_001258122.1.49366 WP_001258122.1.49490 WP_001258122.1.49515 WP_001258122.1.49572 WP_001258122.1.4979 WP_001258122.1.49803 WP_001258122.1.49805 WP_001258122.1.49929 WP_001258122.1.50080 WP_001258122.1.50161 WP_001258122.1.50211 WP_001258122.1.50376 WP_001258122.1.50389 WP_001258122.1.50676 WP_001258122.1.50804 WP_001258122.1.50808 WP_001258122.1.5088 WP_001258122.1.50908 WP_001258122.1.50941 WP_001258122.1.51014 WP_001258122.1.51022 WP_001258122.1.51179 WP_001258122.1.51182 WP_001258122.1.51186 WP_001258122.1.51487 WP_001258122.1.51488 WP_001258122.1.51634 WP_001258122.1.51649 WP_001258122.1.51686 WP_001258122.1.51911 WP_001258122.1.51932 WP_001258122.1.51989 WP_001258122.1.52121 WP_001258122.1.52346 WP_001258122.1.52353 WP_001258122.1.52361 WP_001258122.1.52653 WP_001258122.1.52656 WP_001258122.1.52743 WP_001258122.1.52857 WP_001258122.1.52898 WP_001258122.1.52915 WP_001258122.1.53190 WP_001258122.1.53406 WP_001258122.1.53466 WP_001258122.1.53529 WP_001258122.1.53543 WP_001258122.1.53757 WP_001258122.1.53812 WP_001258122.1.54033 WP_001258122.1.54075 WP_001258122.1.54196 WP_001258122.1.54209 WP_001258122.1.54271 WP_001258122.1.54274 WP_001258122.1.54319 WP_001258122.1.54364 WP_001258122.1.54400 WP_001258122.1.54644 WP_001258122.1.54662 WP_001258122.1.54722 WP_001258122.1.54749 WP_001258122.1.54764 WP_001258122.1.55008 WP_001258122.1.55152 WP_001258122.1.55156 WP_001258122.1.55285 WP_001258122.1.55475 WP_001258122.1.55647 WP_001258122.1.55743 WP_001258122.1.55768 WP_001258122.1.55782 WP_001258122.1.55796 WP_001258122.1.56002 WP_001258122.1.56012 WP_001258122.1.56105 WP_001258122.1.56238 WP_001258122.1.56286 WP_001258122.1.56304 WP_001258122.1.56414 WP_001258122.1.56438 WP_001258122.1.56560 WP_001258122.1.56601 WP_001258122.1.56614 WP_001258122.1.56671 WP_001258122.1.56682 WP_001258122.1.56875 WP_001258122.1.56877 WP_001258122.1.57168 WP_001258122.1.57187 WP_001258122.1.57377 WP_001258122.1.57418 WP_001258122.1.57433 WP_001258122.1.57515 WP_001258122.1.57529 WP_001258122.1.57576 WP_001258122.1.57601 WP_001258122.1.57607 WP_001258122.1.57763 WP_001258122.1.57862 WP_001258122.1.57890 WP_001258122.1.57891 WP_001258122.1.57978 WP_001258122.1.5801 WP_001258122.1.58041 WP_001258122.1.58418 WP_001258122.1.58548 WP_001258122.1.5858 WP_001258122.1.58662 WP_001258122.1.58669 WP_001258122.1.58745 WP_001258122.1.58803 WP_001258122.1.5886 WP_001258122.1.59094 WP_001258122.1.59224 WP_001258122.1.59321 WP_001258122.1.59375 WP_001258122.1.59458 WP_001258122.1.59490 WP_001258122.1.59508 WP_001258122.1.59684 WP_001258122.1.59694 WP_001258122.1.59771 WP_001258122.1.5979 WP_001258122.1.59953 WP_001258122.1.60008 WP_001258122.1.60021 WP_001258122.1.60069 WP_001258122.1.60140 WP_001258122.1.60155 WP_001258122.1.60285 WP_001258122.1.60379 WP_001258122.1.60464 WP_001258122.1.60874 WP_001258122.1.60941 WP_001258122.1.61078 WP_001258122.1.6114 WP_001258122.1.61232 WP_001258122.1.6129 WP_001258122.1.61296 WP_001258122.1.61345 WP_001258122.1.61417 WP_001258122.1.61574 WP_001258122.1.61712 WP_001258122.1.61714 WP_001258122.1.61730 WP_001258122.1.61857 WP_001258122.1.61918 WP_001258122.1.61952 WP_001258122.1.62007 WP_001258122.1.62025 WP_001258122.1.62204 WP_001258122.1.62304 WP_001258122.1.62364 WP_001258122.1.62374 WP_001258122.1.62403 WP_001258122.1.6253 WP_001258122.1.62853 WP_001258122.1.62903 WP_001258122.1.62910 WP_001258122.1.62955 WP_001258122.1.63181 WP_001258122.1.63203 WP_001258122.1.63256 WP_001258122.1.63290 WP_001258122.1.63382 WP_001258122.1.63432 WP_001258122.1.63461 WP_001258122.1.63479 WP_001258122.1.63577 WP_001258122.1.63664 WP_001258122.1.6375 WP_001258122.1.63757 WP_001258122.1.63834 WP_001258122.1.64046 WP_001258122.1.6423 WP_001258122.1.64244 WP_001258122.1.64403 WP_001258122.1.64649 WP_001258122.1.64702 WP_001258122.1.64757 WP_001258122.1.64781 WP_001258122.1.64831 WP_001258122.1.6489 WP_001258122.1.65018 WP_001258122.1.65028 WP_001258122.1.65171 WP_001258122.1.65248 WP_001258122.1.6535 WP_001258122.1.65474 WP_001258122.1.65633 WP_001258122.1.6565 WP_001258122.1.65696 WP_001258122.1.6575 WP_001258122.1.65782 WP_001258122.1.6630 WP_001258122.1.66314 WP_001258122.1.66358 WP_001258122.1.66362 WP_001258122.1.6638 WP_001258122.1.6640 WP_001258122.1.66698 WP_001258122.1.6680 WP_001258122.1.66834 WP_001258122.1.66901 WP_001258122.1.66962 WP_001258122.1.67037 WP_001258122.1.67045 WP_001258122.1.67181 WP_001258122.1.67268 WP_001258122.1.67347 WP_001258122.1.67465 WP_001258122.1.67552 WP_001258122.1.67682 WP_001258122.1.67829 WP_001258122.1.67887 WP_001258122.1.68073 WP_001258122.1.68201 WP_001258122.1.68206 WP_001258122.1.6827 WP_001258122.1.68275 WP_001258122.1.6849 WP_001258122.1.68547 WP_001258122.1.68589 WP_001258122.1.68655 WP_001258122.1.68656 WP_001258122.1.68778 WP_001258122.1.68787 WP_001258122.1.68894 WP_001258122.1.68928 WP_001258122.1.68975 WP_001258122.1.69006 WP_001258122.1.6913 WP_001258122.1.69146 WP_001258122.1.69255 WP_001258122.1.69397 WP_001258122.1.69564 WP_001258122.1.69644 WP_001258122.1.69704 WP_001258122.1.7021 WP_001258122.1.70241 WP_001258122.1.70269 WP_001258122.1.70289 WP_001258122.1.70447 WP_001258122.1.70485 WP_001258122.1.70643 WP_001258122.1.70683 WP_001258122.1.70883 WP_001258122.1.70922 WP_001258122.1.70948 WP_001258122.1.71116 WP_001258122.1.71146 WP_001258122.1.71165 WP_001258122.1.71188 WP_001258122.1.71202 WP_001258122.1.71243 WP_001258122.1.71306 WP_001258122.1.71337 WP_001258122.1.71378 WP_001258122.1.71401 WP_001258122.1.71702 WP_001258122.1.71750 WP_001258122.1.71845 WP_001258122.1.71881 WP_001258122.1.71908 WP_001258122.1.71952 WP_001258122.1.71973 WP_001258122.1.72105 WP_001258122.1.72203 WP_001258122.1.72376 WP_001258122.1.72594 WP_001258122.1.72871 WP_001258122.1.72975 WP_001258122.1.7315 WP_001258122.1.73200 WP_001258122.1.7334 WP_001258122.1.73377 WP_001258122.1.73481 WP_001258122.1.7356 WP_001258122.1.73581 WP_001258122.1.73617 WP_001258122.1.73753 WP_001258122.1.73758 WP_001258122.1.73794 WP_001258122.1.7387 WP_001258122.1.73924 WP_001258122.1.74029 WP_001258122.1.74181 WP_001258122.1.74191 WP_001258122.1.7433 WP_001258122.1.74379 WP_001258122.1.74410 WP_001258122.1.74466 WP_001258122.1.74529 WP_001258122.1.74545 WP_001258122.1.74745 WP_001258122.1.75129 WP_001258122.1.75187 WP_001258122.1.75288 WP_001258122.1.75334 WP_001258122.1.75362 WP_001258122.1.75385 WP_001258122.1.75392 WP_001258122.1.75760 WP_001258122.1.75764 WP_001258122.1.75837 WP_001258122.1.75874 WP_001258122.1.75945 WP_001258122.1.76020 WP_001258122.1.76252 WP_001258122.1.76445 WP_001258122.1.7660 WP_001258122.1.76673 WP_001258122.1.76706 WP_001258122.1.76721 WP_001258122.1.76756 WP_001258122.1.76760 WP_001258122.1.76875 WP_001258122.1.76880 WP_001258122.1.76899 WP_001258122.1.77038 WP_001258122.1.77047 WP_001258122.1.77080 WP_001258122.1.7712 WP_001258122.1.77180 WP_001258122.1.77244 WP_001258122.1.77292 WP_001258122.1.77349 WP_001258122.1.77514 WP_001258122.1.77529 WP_001258122.1.77549 WP_001258122.1.77692 WP_001258122.1.7782 WP_001258122.1.77851 WP_001258122.1.77898 WP_001258122.1.77918 WP_001258122.1.77960 WP_001258122.1.78033 WP_001258122.1.78076 WP_001258122.1.78096 WP_001258122.1.78100 WP_001258122.1.78110 WP_001258122.1.78120 WP_001258122.1.78383 WP_001258122.1.78407 WP_001258122.1.7861 WP_001258122.1.78618 WP_001258122.1.78673 WP_001258122.1.78735 WP_001258122.1.78802 WP_001258122.1.78830 WP_001258122.1.78835 WP_001258122.1.78871 WP_001258122.1.78874 WP_001258122.1.78918 WP_001258122.1.78930 WP_001258122.1.79151 WP_001258122.1.79167 WP_001258122.1.79335 WP_001258122.1.79462 WP_001258122.1.79472 WP_001258122.1.79490 WP_001258122.1.79495 WP_001258122.1.79529 WP_001258122.1.79570 WP_001258122.1.7964 WP_001258122.1.79659 WP_001258122.1.79668 WP_001258122.1.79708 WP_001258122.1.79845 WP_001258122.1.80077 WP_001258122.1.80137 WP_001258122.1.80182 WP_001258122.1.80296 WP_001258122.1.80366 WP_001258122.1.80780 WP_001258122.1.80831 WP_001258122.1.80850 WP_001258122.1.80881 WP_001258122.1.80939 WP_001258122.1.8096 WP_001258122.1.81037 WP_001258122.1.81069 WP_001258122.1.81149 WP_001258122.1.81175 WP_001258122.1.8119 WP_001258122.1.81193 WP_001258122.1.81354 WP_001258122.1.81425 WP_001258122.1.81750 WP_001258122.1.81785 WP_001258122.1.81902 WP_001258122.1.81974 WP_001258122.1.82337 WP_001258122.1.82479 WP_001258122.1.82503 WP_001258122.1.82515 WP_001258122.1.82676 WP_001258122.1.82761 WP_001258122.1.8282 WP_001258122.1.82944 WP_001258122.1.82956 WP_001258122.1.83092 WP_001258122.1.83163 WP_001258122.1.83305 WP_001258122.1.83413 WP_001258122.1.83491 WP_001258122.1.83523 WP_001258122.1.8354 WP_001258122.1.83721 WP_001258122.1.83760 WP_001258122.1.83995 WP_001258122.1.84103 WP_001258122.1.84283 WP_001258122.1.84392 WP_001258122.1.8441 WP_001258122.1.84532 WP_001258122.1.84554 WP_001258122.1.84659 WP_001258122.1.84899 WP_001258122.1.8497 WP_001258122.1.85040 WP_001258122.1.85134 WP_001258122.1.85178 WP_001258122.1.85180 WP_001258122.1.85190 WP_001258122.1.8545 WP_001258122.1.85481 WP_001258122.1.85483 WP_001258122.1.8556 WP_001258122.1.85615 WP_001258122.1.85617 WP_001258122.1.85663 WP_001258122.1.85671 WP_001258122.1.85672 WP_001258122.1.85777 WP_001258122.1.85886 WP_001258122.1.85900 WP_001258122.1.85904 WP_001258122.1.85976 WP_001258122.1.86306 WP_001258122.1.86356 WP_001258122.1.86450 WP_001258122.1.86469 WP_001258122.1.86580 WP_001258122.1.86588 WP_001258122.1.86661 WP_001258122.1.8672 WP_001258122.1.8678 WP_001258122.1.86810 WP_001258122.1.8684 WP_001258122.1.86895 WP_001258122.1.86906 WP_001258122.1.87095 WP_001258122.1.8736 WP_001258122.1.87552 WP_001258122.1.87779 WP_001258122.1.87945 WP_001258122.1.88019 WP_001258122.1.88073 WP_001258122.1.8809 WP_001258122.1.88291 WP_001258122.1.8837 WP_001258122.1.88393 WP_001258122.1.88703 WP_001258122.1.88792 WP_001258122.1.88902 WP_001258122.1.8891 WP_001258122.1.89008 WP_001258122.1.89116 WP_001258122.1.89138 WP_001258122.1.89304 WP_001258122.1.89512 WP_001258122.1.89527 WP_001258122.1.89570 WP_001258122.1.89604 WP_001258122.1.89622 WP_001258122.1.89902 WP_001258122.1.8996 WP_001258122.1.90097 WP_001258122.1.90252 WP_001258122.1.90417 WP_001258122.1.90453 WP_001258122.1.90458 WP_001258122.1.90557 WP_001258122.1.90585 WP_001258122.1.90641 WP_001258122.1.90734 WP_001258122.1.91003 WP_001258122.1.91069 WP_001258122.1.91278 WP_001258122.1.91512 WP_001258122.1.91564 WP_001258122.1.91628 WP_001258122.1.91655 WP_001258122.1.91724 WP_001258122.1.91732 WP_001258122.1.91788 WP_001258122.1.92013 WP_001258122.1.92093 WP_001258122.1.92108 WP_001258122.1.92183 WP_001258122.1.92208 WP_001258122.1.92268 WP_001258122.1.92310 WP_001258122.1.92443 WP_001258122.1.92482 WP_001258122.1.92531 WP_001258122.1.92669 WP_001258122.1.92671 WP_001258122.1.92738 WP_001258122.1.93086 WP_001258122.1.93101 WP_001258122.1.93136 WP_001258122.1.93155 WP_001258122.1.93365 WP_001258122.1.93543 WP_001258122.1.93650 WP_001258122.1.93656 WP_001258122.1.93662 WP_001258122.1.937 WP_001258122.1.93705 WP_001258122.1.93804 WP_001258122.1.9389 WP_001258122.1.93994 WP_001258122.1.94072 WP_001258122.1.94162 WP_001258122.1.94168 WP_001258122.1.94198 WP_001258122.1.9432 WP_001258122.1.94354 WP_001258122.1.94380 WP_001258122.1.94458 WP_001258122.1.94565 WP_001258122.1.94584 WP_001258122.1.94674 WP_001258122.1.94796 WP_001258122.1.94959 WP_001258122.1.95051 WP_001258122.1.95085 WP_001258122.1.95121 WP_001258122.1.95282 WP_001258122.1.95546 WP_001258122.1.95630 WP_001258122.1.95911 WP_001258122.1.96139 WP_001258122.1.96317 WP_001258122.1.96343 WP_001258122.1.9644 WP_001258122.1.96469 WP_001258122.1.96500 WP_001258122.1.96555 WP_001258122.1.96563 WP_001258122.1.96732 WP_001258122.1.96771 WP_001258122.1.97015 WP_001258122.1.97145 WP_001258122.1.97190 WP_001258122.1.97318 WP_001258122.1.97369 WP_001258122.1.97597 WP_001258122.1.97613 WP_001258122.1.97620 WP_001258122.1.97727 WP_001258122.1.97732 WP_001258122.1.97736 WP_001258122.1.9775 WP_001258122.1.97846 WP_001258122.1.98006 WP_001258122.1.98019 WP_001258122.1.98022 WP_001258122.1.98110 WP_001258122.1.98146 WP_001258122.1.98219 WP_001258122.1.9841 WP_001258122.1.98495 WP_001258122.1.98531 WP_001258122.1.98577 WP_001258122.1.98676 WP_001258122.1.98677 WP_001258122.1.98760 WP_001258122.1.98843 WP_001258122.1.9898 WP_001258122.1.99098 WP_001258122.1.99184 WP_001258122.1.99267 WP_001258122.1.99276 WP_001258122.1.99646 WP_001258122.1.99657 WP_001258122.1.99660 WP_001258122.1.99712 WP_001258122.1.99813 WP_001258122.1.99858 WP_001258122.1.99889 WP_001258122.1.99958 gi|379699771|ref|YP_005241499.1| gi|378698510|ref|YP_005180467.1| gi|525839011|ref|YP_008256208.1| gi|482904863|ref|YP_007903423.1| gi|549723260|ref|YP_008643450.1| gi|378983155|ref|YP_005246310.1| ABAO01000003|CDS_111240-110518 AE006468|CDS_612214-611492 CP001363|CDS_612908-612186 FN424405|CDS_651024-650302 gi|16763930|ref|NP_459545.1| gi|378444050|ref|YP_005231682.1| gi|383495356|ref|YP_005396045.1| 99287.STM0550 gi|378448896|ref|YP_005236255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]