SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC23989 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC23989
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000589
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC23989
Sequence length 98
Comment $ MCSG $ SQ17909 $ PDBT63313 $
Sequence
MTPQLTWTREADTLVLAGELDQDVLAPLWDARVEAMNGVTRIDLSQISRVDTGGLALLAH
LVNQAKKQGNAVSLSGVNDKVYALAQLYNLPEDVLPRM
Download sequence
Identical sequences A0A0F6B796 A0A0F7JC40 A0A0H3BW01 A0A0H3NM88 A0A0M0PYR7 A0A0M2J5H4 A0A0N1R0T0 A0A0R9MXM7 A0A0U0WWA6 A0A0U1F2K2 A0A1S1AIN7 A0A1X2RH97 A0A1X2ULP5 A0A1Z3QA48 A0A249UTR4 A0A265B3K3 A0A267SDX4 A0A271CFS0 A0A2C6FVR9 A0A2D3AGT7 A0A2D3TRD8 A0A2H9YBR0 A0A2I6M3H4 A0A2I6MH17 A0A2I6N8Z6 A0A2I6NZI3 A0A2K2ZIK1 B5F6W0 E8XCC6 G5SHD3 Q7CPP4 Q8XGD1 S5HXQ3 V7IGY6
gi|525836862|ref|YP_008253509.1| gi|525814585|ref|YP_008244603.1| APC23989 gi|378961402|ref|YP_005218888.1| gi|526221642|ref|YP_008267507.1| gi|194445872|ref|YP_002042567.1| gi|378990620|ref|YP_005253784.1| 209261.t3226 220341.STY3488 272994.SPAB_04127 423368.SNSL254_A3570 439843.SeSA_A3501 454166.SeAg_B3499 454169.SeHA_C3606 99287.STM3309 gi|161616319|ref|YP_001590284.1| gi|16762071|ref|NP_457688.1| gi|378446695|ref|YP_005234327.1| gi|525945995|ref|YP_008307025.1| gi|538363908|ref|YP_008507193.1| gi|563654662|ref|YP_008862748.1| gi|379702570|ref|YP_005244298.1| gi|528821144|ref|YP_008362347.1| NP_457688.1.84458 NP_462219.1.58477 WP_000188843.1.100002 WP_000188843.1.100008 WP_000188843.1.100010 WP_000188843.1.100036 WP_000188843.1.100079 WP_000188843.1.100115 WP_000188843.1.10013 WP_000188843.1.100137 WP_000188843.1.100165 WP_000188843.1.100196 WP_000188843.1.1002 WP_000188843.1.100234 WP_000188843.1.100258 WP_000188843.1.100284 WP_000188843.1.100313 WP_000188843.1.100314 WP_000188843.1.100321 WP_000188843.1.100354 WP_000188843.1.100376 WP_000188843.1.100413 WP_000188843.1.100421 WP_000188843.1.100424 WP_000188843.1.100432 WP_000188843.1.100436 WP_000188843.1.100446 WP_000188843.1.100450 WP_000188843.1.100472 WP_000188843.1.100484 WP_000188843.1.100488 WP_000188843.1.100502 WP_000188843.1.100521 WP_000188843.1.100592 WP_000188843.1.100597 WP_000188843.1.100610 WP_000188843.1.100650 WP_000188843.1.100707 WP_000188843.1.100711 WP_000188843.1.100721 WP_000188843.1.100730 WP_000188843.1.100732 WP_000188843.1.100733 WP_000188843.1.100739 WP_000188843.1.10076 WP_000188843.1.100764 WP_000188843.1.100781 WP_000188843.1.100790 WP_000188843.1.100793 WP_000188843.1.100799 WP_000188843.1.100869 WP_000188843.1.100870 WP_000188843.1.100871 WP_000188843.1.100882 WP_000188843.1.100932 WP_000188843.1.100941 WP_000188843.1.100948 WP_000188843.1.100953 WP_000188843.1.101011 WP_000188843.1.101020 WP_000188843.1.101074 WP_000188843.1.101078 WP_000188843.1.10108 WP_000188843.1.101094 WP_000188843.1.101147 WP_000188843.1.101180 WP_000188843.1.101185 WP_000188843.1.101226 WP_000188843.1.10124 WP_000188843.1.101259 WP_000188843.1.101271 WP_000188843.1.101284 WP_000188843.1.101291 WP_000188843.1.1013 WP_000188843.1.101312 WP_000188843.1.101320 WP_000188843.1.101322 WP_000188843.1.101353 WP_000188843.1.101374 WP_000188843.1.101386 WP_000188843.1.101404 WP_000188843.1.101420 WP_000188843.1.101473 WP_000188843.1.101520 WP_000188843.1.101589 WP_000188843.1.101616 WP_000188843.1.101639 WP_000188843.1.10164 WP_000188843.1.101707 WP_000188843.1.101734 WP_000188843.1.101741 WP_000188843.1.10177 WP_000188843.1.101776 WP_000188843.1.101890 WP_000188843.1.101941 WP_000188843.1.101953 WP_000188843.1.102050 WP_000188843.1.102087 WP_000188843.1.10220 WP_000188843.1.10231 WP_000188843.1.10266 WP_000188843.1.10293 WP_000188843.1.10310 WP_000188843.1.10338 WP_000188843.1.1038 WP_000188843.1.104 WP_000188843.1.10401 WP_000188843.1.10428 WP_000188843.1.10429 WP_000188843.1.10439 WP_000188843.1.10459 WP_000188843.1.10463 WP_000188843.1.10475 WP_000188843.1.10507 WP_000188843.1.10511 WP_000188843.1.10514 WP_000188843.1.10530 WP_000188843.1.10532 WP_000188843.1.10547 WP_000188843.1.10566 WP_000188843.1.10568 WP_000188843.1.10595 WP_000188843.1.106 WP_000188843.1.10642 WP_000188843.1.10654 WP_000188843.1.10675 WP_000188843.1.10677 WP_000188843.1.10678 WP_000188843.1.10753 WP_000188843.1.10797 WP_000188843.1.10857 WP_000188843.1.10873 WP_000188843.1.10926 WP_000188843.1.10936 WP_000188843.1.10992 WP_000188843.1.11000 WP_000188843.1.11012 WP_000188843.1.11024 WP_000188843.1.11031 WP_000188843.1.11055 WP_000188843.1.11098 WP_000188843.1.1110 WP_000188843.1.11126 WP_000188843.1.11142 WP_000188843.1.11156 WP_000188843.1.11168 WP_000188843.1.11190 WP_000188843.1.11213 WP_000188843.1.11239 WP_000188843.1.11253 WP_000188843.1.11254 WP_000188843.1.11295 WP_000188843.1.11314 WP_000188843.1.11362 WP_000188843.1.11369 WP_000188843.1.11385 WP_000188843.1.11405 WP_000188843.1.1142 WP_000188843.1.11426 WP_000188843.1.11429 WP_000188843.1.11455 WP_000188843.1.11458 WP_000188843.1.11518 WP_000188843.1.11532 WP_000188843.1.11543 WP_000188843.1.11544 WP_000188843.1.11557 WP_000188843.1.11567 WP_000188843.1.11588 WP_000188843.1.11621 WP_000188843.1.11638 WP_000188843.1.11677 WP_000188843.1.11681 WP_000188843.1.11687 WP_000188843.1.11735 WP_000188843.1.11763 WP_000188843.1.11772 WP_000188843.1.11834 WP_000188843.1.11865 WP_000188843.1.11875 WP_000188843.1.11883 WP_000188843.1.11897 WP_000188843.1.11908 WP_000188843.1.11914 WP_000188843.1.12017 WP_000188843.1.12025 WP_000188843.1.12040 WP_000188843.1.12059 WP_000188843.1.12061 WP_000188843.1.12063 WP_000188843.1.1207 WP_000188843.1.12114 WP_000188843.1.12141 WP_000188843.1.12160 WP_000188843.1.12172 WP_000188843.1.12192 WP_000188843.1.1224 WP_000188843.1.12244 WP_000188843.1.12280 WP_000188843.1.12351 WP_000188843.1.12364 WP_000188843.1.12370 WP_000188843.1.12396 WP_000188843.1.12397 WP_000188843.1.12398 WP_000188843.1.12441 WP_000188843.1.1246 WP_000188843.1.12546 WP_000188843.1.12581 WP_000188843.1.12584 WP_000188843.1.12620 WP_000188843.1.1264 WP_000188843.1.12648 WP_000188843.1.12650 WP_000188843.1.12683 WP_000188843.1.12718 WP_000188843.1.12726 WP_000188843.1.12727 WP_000188843.1.12728 WP_000188843.1.12741 WP_000188843.1.12834 WP_000188843.1.12879 WP_000188843.1.12936 WP_000188843.1.1299 WP_000188843.1.12995 WP_000188843.1.13027 WP_000188843.1.13106 WP_000188843.1.13108 WP_000188843.1.13130 WP_000188843.1.13161 WP_000188843.1.13207 WP_000188843.1.1321 WP_000188843.1.1326 WP_000188843.1.13268 WP_000188843.1.13291 WP_000188843.1.133 WP_000188843.1.13311 WP_000188843.1.13314 WP_000188843.1.13334 WP_000188843.1.13338 WP_000188843.1.13342 WP_000188843.1.13352 WP_000188843.1.13406 WP_000188843.1.13414 WP_000188843.1.13440 WP_000188843.1.13443 WP_000188843.1.13476 WP_000188843.1.13488 WP_000188843.1.13509 WP_000188843.1.13528 WP_000188843.1.13599 WP_000188843.1.13661 WP_000188843.1.13669 WP_000188843.1.13677 WP_000188843.1.13686 WP_000188843.1.1372 WP_000188843.1.13732 WP_000188843.1.13741 WP_000188843.1.13799 WP_000188843.1.13819 WP_000188843.1.1382 WP_000188843.1.13827 WP_000188843.1.13829 WP_000188843.1.1387 WP_000188843.1.13908 WP_000188843.1.13932 WP_000188843.1.13968 WP_000188843.1.1397 WP_000188843.1.13972 WP_000188843.1.140 WP_000188843.1.14001 WP_000188843.1.1401 WP_000188843.1.1408 WP_000188843.1.14089 WP_000188843.1.14099 WP_000188843.1.14111 WP_000188843.1.14120 WP_000188843.1.14123 WP_000188843.1.14150 WP_000188843.1.14151 WP_000188843.1.14191 WP_000188843.1.14197 WP_000188843.1.14239 WP_000188843.1.14280 WP_000188843.1.14286 WP_000188843.1.14296 WP_000188843.1.14320 WP_000188843.1.14333 WP_000188843.1.14379 WP_000188843.1.14399 WP_000188843.1.14406 WP_000188843.1.14410 WP_000188843.1.14436 WP_000188843.1.14444 WP_000188843.1.14458 WP_000188843.1.14466 WP_000188843.1.14467 WP_000188843.1.14474 WP_000188843.1.14500 WP_000188843.1.14505 WP_000188843.1.14516 WP_000188843.1.14524 WP_000188843.1.14526 WP_000188843.1.14528 WP_000188843.1.14550 WP_000188843.1.14554 WP_000188843.1.14575 WP_000188843.1.14618 WP_000188843.1.14688 WP_000188843.1.14701 WP_000188843.1.14703 WP_000188843.1.14706 WP_000188843.1.14719 WP_000188843.1.14725 WP_000188843.1.1473 WP_000188843.1.14737 WP_000188843.1.14765 WP_000188843.1.14789 WP_000188843.1.14808 WP_000188843.1.14810 WP_000188843.1.14852 WP_000188843.1.14877 WP_000188843.1.1489 WP_000188843.1.14894 WP_000188843.1.14930 WP_000188843.1.14932 WP_000188843.1.14947 WP_000188843.1.14948 WP_000188843.1.15046 WP_000188843.1.15054 WP_000188843.1.15055 WP_000188843.1.15079 WP_000188843.1.15102 WP_000188843.1.15124 WP_000188843.1.15184 WP_000188843.1.15223 WP_000188843.1.15226 WP_000188843.1.15244 WP_000188843.1.15265 WP_000188843.1.15316 WP_000188843.1.15353 WP_000188843.1.15362 WP_000188843.1.15369 WP_000188843.1.1540 WP_000188843.1.15415 WP_000188843.1.15423 WP_000188843.1.15433 WP_000188843.1.15439 WP_000188843.1.15479 WP_000188843.1.15483 WP_000188843.1.15487 WP_000188843.1.15508 WP_000188843.1.1551 WP_000188843.1.15535 WP_000188843.1.15581 WP_000188843.1.15597 WP_000188843.1.15616 WP_000188843.1.15625 WP_000188843.1.15644 WP_000188843.1.15708 WP_000188843.1.15710 WP_000188843.1.15717 WP_000188843.1.15784 WP_000188843.1.15795 WP_000188843.1.15830 WP_000188843.1.15835 WP_000188843.1.15862 WP_000188843.1.15881 WP_000188843.1.15905 WP_000188843.1.15909 WP_000188843.1.15910 WP_000188843.1.15912 WP_000188843.1.15922 WP_000188843.1.15970 WP_000188843.1.15978 WP_000188843.1.15986 WP_000188843.1.16004 WP_000188843.1.16006 WP_000188843.1.16032 WP_000188843.1.16046 WP_000188843.1.16047 WP_000188843.1.16051 WP_000188843.1.16052 WP_000188843.1.16058 WP_000188843.1.16062 WP_000188843.1.16063 WP_000188843.1.16103 WP_000188843.1.16125 WP_000188843.1.16150 WP_000188843.1.16155 WP_000188843.1.16158 WP_000188843.1.16166 WP_000188843.1.16172 WP_000188843.1.16226 WP_000188843.1.16233 WP_000188843.1.16244 WP_000188843.1.1626 WP_000188843.1.16264 WP_000188843.1.16273 WP_000188843.1.16284 WP_000188843.1.16328 WP_000188843.1.16331 WP_000188843.1.16344 WP_000188843.1.1635 WP_000188843.1.16361 WP_000188843.1.16452 WP_000188843.1.16461 WP_000188843.1.16462 WP_000188843.1.16465 WP_000188843.1.16468 WP_000188843.1.16522 WP_000188843.1.16525 WP_000188843.1.16588 WP_000188843.1.16614 WP_000188843.1.16650 WP_000188843.1.16656 WP_000188843.1.16658 WP_000188843.1.16666 WP_000188843.1.16673 WP_000188843.1.16686 WP_000188843.1.16691 WP_000188843.1.167 WP_000188843.1.16732 WP_000188843.1.16735 WP_000188843.1.1674 WP_000188843.1.16767 WP_000188843.1.16781 WP_000188843.1.16786 WP_000188843.1.16804 WP_000188843.1.16819 WP_000188843.1.16826 WP_000188843.1.16855 WP_000188843.1.16858 WP_000188843.1.16873 WP_000188843.1.16879 WP_000188843.1.16893 WP_000188843.1.16896 WP_000188843.1.16903 WP_000188843.1.16905 WP_000188843.1.16916 WP_000188843.1.16941 WP_000188843.1.16944 WP_000188843.1.16948 WP_000188843.1.16965 WP_000188843.1.1700 WP_000188843.1.17049 WP_000188843.1.17058 WP_000188843.1.17078 WP_000188843.1.17093 WP_000188843.1.17202 WP_000188843.1.17219 WP_000188843.1.1722 WP_000188843.1.17270 WP_000188843.1.17285 WP_000188843.1.17302 WP_000188843.1.17307 WP_000188843.1.17308 WP_000188843.1.17368 WP_000188843.1.1737 WP_000188843.1.17390 WP_000188843.1.174 WP_000188843.1.17405 WP_000188843.1.17406 WP_000188843.1.17447 WP_000188843.1.17480 WP_000188843.1.17513 WP_000188843.1.17543 WP_000188843.1.17546 WP_000188843.1.17563 WP_000188843.1.17578 WP_000188843.1.17622 WP_000188843.1.17659 WP_000188843.1.17667 WP_000188843.1.17686 WP_000188843.1.17693 WP_000188843.1.17702 WP_000188843.1.17705 WP_000188843.1.17741 WP_000188843.1.17743 WP_000188843.1.17747 WP_000188843.1.17840 WP_000188843.1.17865 WP_000188843.1.17891 WP_000188843.1.17919 WP_000188843.1.17949 WP_000188843.1.17956 WP_000188843.1.1798 WP_000188843.1.17991 WP_000188843.1.18005 WP_000188843.1.1801 WP_000188843.1.18019 WP_000188843.1.18021 WP_000188843.1.1807 WP_000188843.1.18099 WP_000188843.1.18111 WP_000188843.1.18122 WP_000188843.1.18124 WP_000188843.1.1814 WP_000188843.1.18144 WP_000188843.1.18163 WP_000188843.1.18173 WP_000188843.1.1818 WP_000188843.1.18249 WP_000188843.1.18254 WP_000188843.1.18265 WP_000188843.1.18267 WP_000188843.1.18270 WP_000188843.1.18277 WP_000188843.1.18280 WP_000188843.1.18281 WP_000188843.1.18282 WP_000188843.1.18328 WP_000188843.1.18358 WP_000188843.1.18365 WP_000188843.1.18370 WP_000188843.1.18406 WP_000188843.1.18441 WP_000188843.1.18445 WP_000188843.1.18468 WP_000188843.1.18474 WP_000188843.1.18485 WP_000188843.1.18489 WP_000188843.1.18513 WP_000188843.1.18607 WP_000188843.1.18610 WP_000188843.1.18678 WP_000188843.1.18692 WP_000188843.1.18705 WP_000188843.1.18715 WP_000188843.1.18722 WP_000188843.1.18766 WP_000188843.1.18776 WP_000188843.1.1880 WP_000188843.1.18822 WP_000188843.1.1885 WP_000188843.1.18860 WP_000188843.1.18881 WP_000188843.1.18919 WP_000188843.1.18922 WP_000188843.1.18940 WP_000188843.1.18949 WP_000188843.1.18959 WP_000188843.1.1897 WP_000188843.1.18972 WP_000188843.1.19001 WP_000188843.1.19006 WP_000188843.1.19044 WP_000188843.1.19053 WP_000188843.1.19055 WP_000188843.1.19084 WP_000188843.1.19163 WP_000188843.1.19174 WP_000188843.1.19187 WP_000188843.1.19228 WP_000188843.1.19273 WP_000188843.1.19288 WP_000188843.1.19300 WP_000188843.1.19320 WP_000188843.1.19340 WP_000188843.1.19405 WP_000188843.1.19422 WP_000188843.1.19454 WP_000188843.1.19456 WP_000188843.1.19458 WP_000188843.1.19460 WP_000188843.1.19461 WP_000188843.1.19469 WP_000188843.1.19496 WP_000188843.1.19535 WP_000188843.1.19538 WP_000188843.1.19588 WP_000188843.1.19589 WP_000188843.1.19614 WP_000188843.1.19616 WP_000188843.1.19642 WP_000188843.1.19660 WP_000188843.1.19663 WP_000188843.1.19686 WP_000188843.1.19702 WP_000188843.1.19706 WP_000188843.1.19724 WP_000188843.1.19731 WP_000188843.1.19749 WP_000188843.1.19784 WP_000188843.1.19793 WP_000188843.1.19794 WP_000188843.1.19802 WP_000188843.1.19809 WP_000188843.1.19823 WP_000188843.1.19863 WP_000188843.1.19867 WP_000188843.1.1992 WP_000188843.1.19975 WP_000188843.1.1998 WP_000188843.1.19999 WP_000188843.1.20 WP_000188843.1.20034 WP_000188843.1.20081 WP_000188843.1.20091 WP_000188843.1.2010 WP_000188843.1.20119 WP_000188843.1.20212 WP_000188843.1.20254 WP_000188843.1.20255 WP_000188843.1.2026 WP_000188843.1.20266 WP_000188843.1.20271 WP_000188843.1.20296 WP_000188843.1.20330 WP_000188843.1.20339 WP_000188843.1.20362 WP_000188843.1.20364 WP_000188843.1.20376 WP_000188843.1.20391 WP_000188843.1.20418 WP_000188843.1.20419 WP_000188843.1.20425 WP_000188843.1.20443 WP_000188843.1.20446 WP_000188843.1.20465 WP_000188843.1.20492 WP_000188843.1.20503 WP_000188843.1.20525 WP_000188843.1.2053 WP_000188843.1.2054 WP_000188843.1.20553 WP_000188843.1.20573 WP_000188843.1.20614 WP_000188843.1.20626 WP_000188843.1.20635 WP_000188843.1.20646 WP_000188843.1.20695 WP_000188843.1.20700 WP_000188843.1.20718 WP_000188843.1.20721 WP_000188843.1.2073 WP_000188843.1.20740 WP_000188843.1.20787 WP_000188843.1.20795 WP_000188843.1.20810 WP_000188843.1.20828 WP_000188843.1.20839 WP_000188843.1.2087 WP_000188843.1.20883 WP_000188843.1.20908 WP_000188843.1.2091 WP_000188843.1.20947 WP_000188843.1.20953 WP_000188843.1.2101 WP_000188843.1.21010 WP_000188843.1.21049 WP_000188843.1.2106 WP_000188843.1.21062 WP_000188843.1.21086 WP_000188843.1.21136 WP_000188843.1.21144 WP_000188843.1.21146 WP_000188843.1.21162 WP_000188843.1.21165 WP_000188843.1.21184 WP_000188843.1.21185 WP_000188843.1.21245 WP_000188843.1.21246 WP_000188843.1.21269 WP_000188843.1.21351 WP_000188843.1.21362 WP_000188843.1.21366 WP_000188843.1.21400 WP_000188843.1.21423 WP_000188843.1.21473 WP_000188843.1.21492 WP_000188843.1.21497 WP_000188843.1.21499 WP_000188843.1.21548 WP_000188843.1.21603 WP_000188843.1.2166 WP_000188843.1.21674 WP_000188843.1.21750 WP_000188843.1.21751 WP_000188843.1.21757 WP_000188843.1.21792 WP_000188843.1.21825 WP_000188843.1.21946 WP_000188843.1.21966 WP_000188843.1.21991 WP_000188843.1.22024 WP_000188843.1.22030 WP_000188843.1.2205 WP_000188843.1.22062 WP_000188843.1.22064 WP_000188843.1.22067 WP_000188843.1.22069 WP_000188843.1.22118 WP_000188843.1.22126 WP_000188843.1.2216 WP_000188843.1.22208 WP_000188843.1.2221 WP_000188843.1.22235 WP_000188843.1.2224 WP_000188843.1.2227 WP_000188843.1.22315 WP_000188843.1.2235 WP_000188843.1.22373 WP_000188843.1.22379 WP_000188843.1.22427 WP_000188843.1.22453 WP_000188843.1.2246 WP_000188843.1.22476 WP_000188843.1.22485 WP_000188843.1.22514 WP_000188843.1.22537 WP_000188843.1.22575 WP_000188843.1.22582 WP_000188843.1.22604 WP_000188843.1.22614 WP_000188843.1.22620 WP_000188843.1.22623 WP_000188843.1.22652 WP_000188843.1.22683 WP_000188843.1.22692 WP_000188843.1.22758 WP_000188843.1.2284 WP_000188843.1.22864 WP_000188843.1.22870 WP_000188843.1.22895 WP_000188843.1.22926 WP_000188843.1.22943 WP_000188843.1.22966 WP_000188843.1.22967 WP_000188843.1.22979 WP_000188843.1.23010 WP_000188843.1.23040 WP_000188843.1.23053 WP_000188843.1.23058 WP_000188843.1.23080 WP_000188843.1.23102 WP_000188843.1.23114 WP_000188843.1.2314 WP_000188843.1.23155 WP_000188843.1.23169 WP_000188843.1.23172 WP_000188843.1.23192 WP_000188843.1.23218 WP_000188843.1.23258 WP_000188843.1.23259 WP_000188843.1.2331 WP_000188843.1.2332 WP_000188843.1.23340 WP_000188843.1.2336 WP_000188843.1.23365 WP_000188843.1.23379 WP_000188843.1.23409 WP_000188843.1.23412 WP_000188843.1.23426 WP_000188843.1.23460 WP_000188843.1.23466 WP_000188843.1.23472 WP_000188843.1.23482 WP_000188843.1.23485 WP_000188843.1.23492 WP_000188843.1.235 WP_000188843.1.23509 WP_000188843.1.23513 WP_000188843.1.23515 WP_000188843.1.23529 WP_000188843.1.23548 WP_000188843.1.23571 WP_000188843.1.23587 WP_000188843.1.23604 WP_000188843.1.23621 WP_000188843.1.23629 WP_000188843.1.23634 WP_000188843.1.2364 WP_000188843.1.23643 WP_000188843.1.23675 WP_000188843.1.23679 WP_000188843.1.23685 WP_000188843.1.23728 WP_000188843.1.23736 WP_000188843.1.2375 WP_000188843.1.23783 WP_000188843.1.23786 WP_000188843.1.23787 WP_000188843.1.23801 WP_000188843.1.23819 WP_000188843.1.23932 WP_000188843.1.23959 WP_000188843.1.24017 WP_000188843.1.24028 WP_000188843.1.24061 WP_000188843.1.24082 WP_000188843.1.24083 WP_000188843.1.24117 WP_000188843.1.24125 WP_000188843.1.24138 WP_000188843.1.24153 WP_000188843.1.24158 WP_000188843.1.24206 WP_000188843.1.24259 WP_000188843.1.24291 WP_000188843.1.24303 WP_000188843.1.24308 WP_000188843.1.24322 WP_000188843.1.24325 WP_000188843.1.24355 WP_000188843.1.24375 WP_000188843.1.24400 WP_000188843.1.24412 WP_000188843.1.24420 WP_000188843.1.24521 WP_000188843.1.24578 WP_000188843.1.24619 WP_000188843.1.24643 WP_000188843.1.24688 WP_000188843.1.24696 WP_000188843.1.24716 WP_000188843.1.24723 WP_000188843.1.24737 WP_000188843.1.24779 WP_000188843.1.2481 WP_000188843.1.24832 WP_000188843.1.24837 WP_000188843.1.24873 WP_000188843.1.24964 WP_000188843.1.25008 WP_000188843.1.25015 WP_000188843.1.25017 WP_000188843.1.25032 WP_000188843.1.25036 WP_000188843.1.25041 WP_000188843.1.25053 WP_000188843.1.25119 WP_000188843.1.25140 WP_000188843.1.25185 WP_000188843.1.25196 WP_000188843.1.25205 WP_000188843.1.25206 WP_000188843.1.25210 WP_000188843.1.25217 WP_000188843.1.25219 WP_000188843.1.25229 WP_000188843.1.25304 WP_000188843.1.25374 WP_000188843.1.25397 WP_000188843.1.25405 WP_000188843.1.25454 WP_000188843.1.25475 WP_000188843.1.25490 WP_000188843.1.25493 WP_000188843.1.25498 WP_000188843.1.25508 WP_000188843.1.25512 WP_000188843.1.25514 WP_000188843.1.2554 WP_000188843.1.25603 WP_000188843.1.2562 WP_000188843.1.25666 WP_000188843.1.25668 WP_000188843.1.25690 WP_000188843.1.2570 WP_000188843.1.25740 WP_000188843.1.25793 WP_000188843.1.25807 WP_000188843.1.2581 WP_000188843.1.25814 WP_000188843.1.25821 WP_000188843.1.25833 WP_000188843.1.25835 WP_000188843.1.25882 WP_000188843.1.25911 WP_000188843.1.25932 WP_000188843.1.25962 WP_000188843.1.25963 WP_000188843.1.25988 WP_000188843.1.26001 WP_000188843.1.26027 WP_000188843.1.26030 WP_000188843.1.26075 WP_000188843.1.26093 WP_000188843.1.26107 WP_000188843.1.26129 WP_000188843.1.2615 WP_000188843.1.26199 WP_000188843.1.26217 WP_000188843.1.26224 WP_000188843.1.26230 WP_000188843.1.26232 WP_000188843.1.26269 WP_000188843.1.26272 WP_000188843.1.26282 WP_000188843.1.26286 WP_000188843.1.26288 WP_000188843.1.26311 WP_000188843.1.26319 WP_000188843.1.2634 WP_000188843.1.26363 WP_000188843.1.26394 WP_000188843.1.26426 WP_000188843.1.26429 WP_000188843.1.26440 WP_000188843.1.26491 WP_000188843.1.26493 WP_000188843.1.26512 WP_000188843.1.2654 WP_000188843.1.26551 WP_000188843.1.26554 WP_000188843.1.26567 WP_000188843.1.26576 WP_000188843.1.26582 WP_000188843.1.2660 WP_000188843.1.26636 WP_000188843.1.26646 WP_000188843.1.26689 WP_000188843.1.26709 WP_000188843.1.26741 WP_000188843.1.2679 WP_000188843.1.26833 WP_000188843.1.26856 WP_000188843.1.26883 WP_000188843.1.26908 WP_000188843.1.26919 WP_000188843.1.2692 WP_000188843.1.26928 WP_000188843.1.26980 WP_000188843.1.270 WP_000188843.1.27008 WP_000188843.1.27010 WP_000188843.1.27027 WP_000188843.1.27070 WP_000188843.1.27077 WP_000188843.1.27084 WP_000188843.1.27086 WP_000188843.1.27087 WP_000188843.1.27111 WP_000188843.1.27115 WP_000188843.1.2713 WP_000188843.1.2717 WP_000188843.1.27173 WP_000188843.1.272 WP_000188843.1.27206 WP_000188843.1.27223 WP_000188843.1.27228 WP_000188843.1.2723 WP_000188843.1.27255 WP_000188843.1.27279 WP_000188843.1.27282 WP_000188843.1.27285 WP_000188843.1.27309 WP_000188843.1.27329 WP_000188843.1.27361 WP_000188843.1.27419 WP_000188843.1.27423 WP_000188843.1.27523 WP_000188843.1.27544 WP_000188843.1.27556 WP_000188843.1.27561 WP_000188843.1.27565 WP_000188843.1.27595 WP_000188843.1.27598 WP_000188843.1.2763 WP_000188843.1.27655 WP_000188843.1.27665 WP_000188843.1.27706 WP_000188843.1.27707 WP_000188843.1.27761 WP_000188843.1.2777 WP_000188843.1.27775 WP_000188843.1.27785 WP_000188843.1.27857 WP_000188843.1.27900 WP_000188843.1.27928 WP_000188843.1.27945 WP_000188843.1.27977 WP_000188843.1.27997 WP_000188843.1.28002 WP_000188843.1.28004 WP_000188843.1.28032 WP_000188843.1.2806 WP_000188843.1.2809 WP_000188843.1.28094 WP_000188843.1.28126 WP_000188843.1.28155 WP_000188843.1.28170 WP_000188843.1.28174 WP_000188843.1.28198 WP_000188843.1.2822 WP_000188843.1.28225 WP_000188843.1.28229 WP_000188843.1.28267 WP_000188843.1.2829 WP_000188843.1.28301 WP_000188843.1.28302 WP_000188843.1.2835 WP_000188843.1.28370 WP_000188843.1.28384 WP_000188843.1.28386 WP_000188843.1.28395 WP_000188843.1.284 WP_000188843.1.2845 WP_000188843.1.28479 WP_000188843.1.28504 WP_000188843.1.28514 WP_000188843.1.28538 WP_000188843.1.28575 WP_000188843.1.28612 WP_000188843.1.28625 WP_000188843.1.28627 WP_000188843.1.28655 WP_000188843.1.28692 WP_000188843.1.28694 WP_000188843.1.287 WP_000188843.1.2873 WP_000188843.1.28776 WP_000188843.1.2879 WP_000188843.1.28811 WP_000188843.1.2890 WP_000188843.1.28917 WP_000188843.1.28938 WP_000188843.1.28946 WP_000188843.1.28962 WP_000188843.1.28963 WP_000188843.1.28977 WP_000188843.1.29006 WP_000188843.1.29010 WP_000188843.1.29023 WP_000188843.1.29042 WP_000188843.1.2905 WP_000188843.1.2907 WP_000188843.1.29081 WP_000188843.1.29089 WP_000188843.1.2910 WP_000188843.1.29113 WP_000188843.1.29153 WP_000188843.1.29174 WP_000188843.1.29190 WP_000188843.1.29203 WP_000188843.1.29237 WP_000188843.1.29248 WP_000188843.1.29265 WP_000188843.1.29288 WP_000188843.1.29389 WP_000188843.1.29439 WP_000188843.1.2946 WP_000188843.1.29462 WP_000188843.1.29509 WP_000188843.1.29563 WP_000188843.1.29588 WP_000188843.1.29593 WP_000188843.1.29601 WP_000188843.1.29606 WP_000188843.1.29615 WP_000188843.1.29619 WP_000188843.1.29704 WP_000188843.1.29727 WP_000188843.1.29732 WP_000188843.1.29743 WP_000188843.1.29775 WP_000188843.1.29782 WP_000188843.1.29827 WP_000188843.1.29833 WP_000188843.1.2984 WP_000188843.1.29845 WP_000188843.1.29851 WP_000188843.1.29865 WP_000188843.1.29886 WP_000188843.1.29919 WP_000188843.1.29924 WP_000188843.1.2994 WP_000188843.1.29964 WP_000188843.1.29969 WP_000188843.1.29983 WP_000188843.1.29990 WP_000188843.1.30006 WP_000188843.1.30009 WP_000188843.1.30013 WP_000188843.1.3002 WP_000188843.1.30022 WP_000188843.1.30027 WP_000188843.1.30034 WP_000188843.1.30049 WP_000188843.1.30058 WP_000188843.1.30086 WP_000188843.1.3017 WP_000188843.1.30172 WP_000188843.1.30180 WP_000188843.1.30185 WP_000188843.1.30202 WP_000188843.1.30225 WP_000188843.1.30246 WP_000188843.1.30331 WP_000188843.1.30354 WP_000188843.1.30357 WP_000188843.1.30362 WP_000188843.1.30389 WP_000188843.1.3042 WP_000188843.1.30421 WP_000188843.1.30440 WP_000188843.1.30448 WP_000188843.1.30469 WP_000188843.1.30489 WP_000188843.1.30505 WP_000188843.1.30507 WP_000188843.1.30517 WP_000188843.1.30535 WP_000188843.1.30542 WP_000188843.1.30544 WP_000188843.1.30547 WP_000188843.1.30556 WP_000188843.1.30572 WP_000188843.1.30573 WP_000188843.1.30585 WP_000188843.1.30602 WP_000188843.1.30618 WP_000188843.1.30619 WP_000188843.1.3066 WP_000188843.1.30664 WP_000188843.1.30688 WP_000188843.1.30696 WP_000188843.1.30794 WP_000188843.1.3080 WP_000188843.1.30803 WP_000188843.1.30806 WP_000188843.1.30833 WP_000188843.1.30835 WP_000188843.1.30909 WP_000188843.1.3095 WP_000188843.1.30967 WP_000188843.1.30972 WP_000188843.1.31 WP_000188843.1.31046 WP_000188843.1.31066 WP_000188843.1.31078 WP_000188843.1.31092 WP_000188843.1.31107 WP_000188843.1.31111 WP_000188843.1.31122 WP_000188843.1.3113 WP_000188843.1.31139 WP_000188843.1.31145 WP_000188843.1.31155 WP_000188843.1.31156 WP_000188843.1.31182 WP_000188843.1.31185 WP_000188843.1.3119 WP_000188843.1.31190 WP_000188843.1.31195 WP_000188843.1.31196 WP_000188843.1.31205 WP_000188843.1.3121 WP_000188843.1.31210 WP_000188843.1.31219 WP_000188843.1.31223 WP_000188843.1.3124 WP_000188843.1.31251 WP_000188843.1.31262 WP_000188843.1.31281 WP_000188843.1.31303 WP_000188843.1.3131 WP_000188843.1.31352 WP_000188843.1.31362 WP_000188843.1.31389 WP_000188843.1.31413 WP_000188843.1.31446 WP_000188843.1.31451 WP_000188843.1.31476 WP_000188843.1.31504 WP_000188843.1.31515 WP_000188843.1.31533 WP_000188843.1.31578 WP_000188843.1.31658 WP_000188843.1.31725 WP_000188843.1.31762 WP_000188843.1.31782 WP_000188843.1.31799 WP_000188843.1.31836 WP_000188843.1.3185 WP_000188843.1.31940 WP_000188843.1.31951 WP_000188843.1.31967 WP_000188843.1.31972 WP_000188843.1.32041 WP_000188843.1.32042 WP_000188843.1.3207 WP_000188843.1.32189 WP_000188843.1.32192 WP_000188843.1.32202 WP_000188843.1.32204 WP_000188843.1.32206 WP_000188843.1.32260 WP_000188843.1.32263 WP_000188843.1.32277 WP_000188843.1.32293 WP_000188843.1.32299 WP_000188843.1.32422 WP_000188843.1.32425 WP_000188843.1.32434 WP_000188843.1.32438 WP_000188843.1.32458 WP_000188843.1.32460 WP_000188843.1.32515 WP_000188843.1.32527 WP_000188843.1.32529 WP_000188843.1.32563 WP_000188843.1.32578 WP_000188843.1.32617 WP_000188843.1.32629 WP_000188843.1.32660 WP_000188843.1.3270 WP_000188843.1.32702 WP_000188843.1.32714 WP_000188843.1.32725 WP_000188843.1.32747 WP_000188843.1.32750 WP_000188843.1.3278 WP_000188843.1.32786 WP_000188843.1.32804 WP_000188843.1.32838 WP_000188843.1.32848 WP_000188843.1.32860 WP_000188843.1.32868 WP_000188843.1.3290 WP_000188843.1.32900 WP_000188843.1.32907 WP_000188843.1.32940 WP_000188843.1.32941 WP_000188843.1.3296 WP_000188843.1.32966 WP_000188843.1.32985 WP_000188843.1.33010 WP_000188843.1.33030 WP_000188843.1.33037 WP_000188843.1.3304 WP_000188843.1.3305 WP_000188843.1.33051 WP_000188843.1.33065 WP_000188843.1.33078 WP_000188843.1.33122 WP_000188843.1.33127 WP_000188843.1.33143 WP_000188843.1.3315 WP_000188843.1.33208 WP_000188843.1.33214 WP_000188843.1.33247 WP_000188843.1.33248 WP_000188843.1.33261 WP_000188843.1.33280 WP_000188843.1.33283 WP_000188843.1.333 WP_000188843.1.33313 WP_000188843.1.33339 WP_000188843.1.33382 WP_000188843.1.33392 WP_000188843.1.33490 WP_000188843.1.33492 WP_000188843.1.33501 WP_000188843.1.33529 WP_000188843.1.33553 WP_000188843.1.33580 WP_000188843.1.33592 WP_000188843.1.33609 WP_000188843.1.33659 WP_000188843.1.33689 WP_000188843.1.3370 WP_000188843.1.33730 WP_000188843.1.33741 WP_000188843.1.33817 WP_000188843.1.33825 WP_000188843.1.33840 WP_000188843.1.33894 WP_000188843.1.3392 WP_000188843.1.33926 WP_000188843.1.3394 WP_000188843.1.33957 WP_000188843.1.33969 WP_000188843.1.34001 WP_000188843.1.34022 WP_000188843.1.34043 WP_000188843.1.34059 WP_000188843.1.34075 WP_000188843.1.34084 WP_000188843.1.34107 WP_000188843.1.34118 WP_000188843.1.34179 WP_000188843.1.34211 WP_000188843.1.34214 WP_000188843.1.34234 WP_000188843.1.34257 WP_000188843.1.34279 WP_000188843.1.34284 WP_000188843.1.34319 WP_000188843.1.34330 WP_000188843.1.34376 WP_000188843.1.34382 WP_000188843.1.34417 WP_000188843.1.3445 WP_000188843.1.34453 WP_000188843.1.34484 WP_000188843.1.34496 WP_000188843.1.34517 WP_000188843.1.34530 WP_000188843.1.34610 WP_000188843.1.34659 WP_000188843.1.34665 WP_000188843.1.34667 WP_000188843.1.34694 WP_000188843.1.34751 WP_000188843.1.3476 WP_000188843.1.34808 WP_000188843.1.34817 WP_000188843.1.34824 WP_000188843.1.34834 WP_000188843.1.34856 WP_000188843.1.34881 WP_000188843.1.3489 WP_000188843.1.34932 WP_000188843.1.34962 WP_000188843.1.34975 WP_000188843.1.34977 WP_000188843.1.35001 WP_000188843.1.35040 WP_000188843.1.35045 WP_000188843.1.35074 WP_000188843.1.35129 WP_000188843.1.35175 WP_000188843.1.35184 WP_000188843.1.35193 WP_000188843.1.35240 WP_000188843.1.35274 WP_000188843.1.35404 WP_000188843.1.35408 WP_000188843.1.35425 WP_000188843.1.35429 WP_000188843.1.35446 WP_000188843.1.35460 WP_000188843.1.35463 WP_000188843.1.35503 WP_000188843.1.35509 WP_000188843.1.35532 WP_000188843.1.35560 WP_000188843.1.3557 WP_000188843.1.35590 WP_000188843.1.35628 WP_000188843.1.35648 WP_000188843.1.3566 WP_000188843.1.3570 WP_000188843.1.35712 WP_000188843.1.35713 WP_000188843.1.35736 WP_000188843.1.35791 WP_000188843.1.35795 WP_000188843.1.35809 WP_000188843.1.35835 WP_000188843.1.35868 WP_000188843.1.35870 WP_000188843.1.35892 WP_000188843.1.35916 WP_000188843.1.35938 WP_000188843.1.35940 WP_000188843.1.35966 WP_000188843.1.36000 WP_000188843.1.36003 WP_000188843.1.3601 WP_000188843.1.36017 WP_000188843.1.36034 WP_000188843.1.36036 WP_000188843.1.36069 WP_000188843.1.36157 WP_000188843.1.36229 WP_000188843.1.36232 WP_000188843.1.36291 WP_000188843.1.36298 WP_000188843.1.36308 WP_000188843.1.36323 WP_000188843.1.36343 WP_000188843.1.36460 WP_000188843.1.3649 WP_000188843.1.36495 WP_000188843.1.36526 WP_000188843.1.36547 WP_000188843.1.36564 WP_000188843.1.36567 WP_000188843.1.36579 WP_000188843.1.36609 WP_000188843.1.36617 WP_000188843.1.36618 WP_000188843.1.36643 WP_000188843.1.36663 WP_000188843.1.36690 WP_000188843.1.3670 WP_000188843.1.36701 WP_000188843.1.36705 WP_000188843.1.36725 WP_000188843.1.36765 WP_000188843.1.36779 WP_000188843.1.36792 WP_000188843.1.36798 WP_000188843.1.36802 WP_000188843.1.36821 WP_000188843.1.36853 WP_000188843.1.36885 WP_000188843.1.36899 WP_000188843.1.36918 WP_000188843.1.36931 WP_000188843.1.36950 WP_000188843.1.37013 WP_000188843.1.37014 WP_000188843.1.37021 WP_000188843.1.37028 WP_000188843.1.37063 WP_000188843.1.37073 WP_000188843.1.37100 WP_000188843.1.37111 WP_000188843.1.37112 WP_000188843.1.37133 WP_000188843.1.37147 WP_000188843.1.37158 WP_000188843.1.37176 WP_000188843.1.37199 WP_000188843.1.37200 WP_000188843.1.37256 WP_000188843.1.37258 WP_000188843.1.3728 WP_000188843.1.37293 WP_000188843.1.37303 WP_000188843.1.3734 WP_000188843.1.37363 WP_000188843.1.37370 WP_000188843.1.37376 WP_000188843.1.3744 WP_000188843.1.37498 WP_000188843.1.37504 WP_000188843.1.37513 WP_000188843.1.37558 WP_000188843.1.37584 WP_000188843.1.37590 WP_000188843.1.37593 WP_000188843.1.37600 WP_000188843.1.37610 WP_000188843.1.37613 WP_000188843.1.37618 WP_000188843.1.37659 WP_000188843.1.37662 WP_000188843.1.37666 WP_000188843.1.37675 WP_000188843.1.37687 WP_000188843.1.37691 WP_000188843.1.37761 WP_000188843.1.37775 WP_000188843.1.37777 WP_000188843.1.378 WP_000188843.1.37808 WP_000188843.1.37848 WP_000188843.1.379 WP_000188843.1.37911 WP_000188843.1.37941 WP_000188843.1.37968 WP_000188843.1.37978 WP_000188843.1.37985 WP_000188843.1.38001 WP_000188843.1.38055 WP_000188843.1.38061 WP_000188843.1.38064 WP_000188843.1.38108 WP_000188843.1.38113 WP_000188843.1.38125 WP_000188843.1.38145 WP_000188843.1.3816 WP_000188843.1.38199 WP_000188843.1.38207 WP_000188843.1.38261 WP_000188843.1.38266 WP_000188843.1.38273 WP_000188843.1.3828 WP_000188843.1.383 WP_000188843.1.38310 WP_000188843.1.3834 WP_000188843.1.38341 WP_000188843.1.38351 WP_000188843.1.3838 WP_000188843.1.38381 WP_000188843.1.38393 WP_000188843.1.38408 WP_000188843.1.38440 WP_000188843.1.3848 WP_000188843.1.38486 WP_000188843.1.38515 WP_000188843.1.38569 WP_000188843.1.38595 WP_000188843.1.3860 WP_000188843.1.38609 WP_000188843.1.38613 WP_000188843.1.38642 WP_000188843.1.38673 WP_000188843.1.3869 WP_000188843.1.38693 WP_000188843.1.38734 WP_000188843.1.38781 WP_000188843.1.38857 WP_000188843.1.38877 WP_000188843.1.38882 WP_000188843.1.38913 WP_000188843.1.38983 WP_000188843.1.38995 WP_000188843.1.38996 WP_000188843.1.39003 WP_000188843.1.39038 WP_000188843.1.39056 WP_000188843.1.3907 WP_000188843.1.39105 WP_000188843.1.39113 WP_000188843.1.39136 WP_000188843.1.3914 WP_000188843.1.39147 WP_000188843.1.39161 WP_000188843.1.39183 WP_000188843.1.39197 WP_000188843.1.39210 WP_000188843.1.39229 WP_000188843.1.39235 WP_000188843.1.39265 WP_000188843.1.3931 WP_000188843.1.39385 WP_000188843.1.39405 WP_000188843.1.39420 WP_000188843.1.39435 WP_000188843.1.39449 WP_000188843.1.39466 WP_000188843.1.39471 WP_000188843.1.39502 WP_000188843.1.39512 WP_000188843.1.39530 WP_000188843.1.39553 WP_000188843.1.39556 WP_000188843.1.39584 WP_000188843.1.39619 WP_000188843.1.39620 WP_000188843.1.39624 WP_000188843.1.39629 WP_000188843.1.39659 WP_000188843.1.39667 WP_000188843.1.39722 WP_000188843.1.39723 WP_000188843.1.39724 WP_000188843.1.39763 WP_000188843.1.39775 WP_000188843.1.39862 WP_000188843.1.39879 WP_000188843.1.39890 WP_000188843.1.39921 WP_000188843.1.39923 WP_000188843.1.39941 WP_000188843.1.39945 WP_000188843.1.39947 WP_000188843.1.40008 WP_000188843.1.40017 WP_000188843.1.40072 WP_000188843.1.40073 WP_000188843.1.40095 WP_000188843.1.40097 WP_000188843.1.401 WP_000188843.1.4011 WP_000188843.1.40111 WP_000188843.1.40155 WP_000188843.1.40160 WP_000188843.1.40167 WP_000188843.1.40171 WP_000188843.1.40208 WP_000188843.1.40240 WP_000188843.1.40257 WP_000188843.1.40259 WP_000188843.1.40279 WP_000188843.1.40292 WP_000188843.1.40305 WP_000188843.1.40311 WP_000188843.1.40341 WP_000188843.1.40361 WP_000188843.1.40380 WP_000188843.1.40395 WP_000188843.1.4042 WP_000188843.1.40465 WP_000188843.1.40467 WP_000188843.1.40496 WP_000188843.1.40508 WP_000188843.1.40517 WP_000188843.1.40605 WP_000188843.1.40693 WP_000188843.1.40698 WP_000188843.1.40710 WP_000188843.1.4075 WP_000188843.1.40750 WP_000188843.1.40763 WP_000188843.1.40788 WP_000188843.1.40854 WP_000188843.1.4087 WP_000188843.1.40877 WP_000188843.1.4089 WP_000188843.1.40910 WP_000188843.1.40924 WP_000188843.1.40932 WP_000188843.1.40946 WP_000188843.1.40979 WP_000188843.1.40996 WP_000188843.1.41004 WP_000188843.1.41017 WP_000188843.1.41018 WP_000188843.1.4106 WP_000188843.1.41070 WP_000188843.1.41074 WP_000188843.1.41075 WP_000188843.1.41086 WP_000188843.1.4109 WP_000188843.1.41091 WP_000188843.1.41097 WP_000188843.1.41132 WP_000188843.1.41176 WP_000188843.1.41225 WP_000188843.1.41226 WP_000188843.1.41251 WP_000188843.1.41258 WP_000188843.1.41265 WP_000188843.1.41279 WP_000188843.1.41305 WP_000188843.1.41308 WP_000188843.1.41310 WP_000188843.1.41321 WP_000188843.1.41333 WP_000188843.1.41335 WP_000188843.1.4136 WP_000188843.1.41375 WP_000188843.1.41415 WP_000188843.1.41440 WP_000188843.1.41459 WP_000188843.1.41468 WP_000188843.1.41498 WP_000188843.1.41516 WP_000188843.1.41519 WP_000188843.1.41524 WP_000188843.1.41554 WP_000188843.1.41572 WP_000188843.1.41591 WP_000188843.1.41593 WP_000188843.1.41628 WP_000188843.1.41631 WP_000188843.1.41658 WP_000188843.1.41659 WP_000188843.1.41662 WP_000188843.1.41708 WP_000188843.1.41716 WP_000188843.1.41724 WP_000188843.1.41746 WP_000188843.1.41761 WP_000188843.1.4178 WP_000188843.1.41824 WP_000188843.1.41825 WP_000188843.1.41836 WP_000188843.1.4184 WP_000188843.1.41859 WP_000188843.1.41862 WP_000188843.1.41882 WP_000188843.1.41894 WP_000188843.1.41897 WP_000188843.1.41919 WP_000188843.1.41929 WP_000188843.1.41931 WP_000188843.1.41938 WP_000188843.1.4194 WP_000188843.1.41979 WP_000188843.1.41985 WP_000188843.1.42069 WP_000188843.1.42081 WP_000188843.1.42090 WP_000188843.1.42104 WP_000188843.1.42111 WP_000188843.1.42156 WP_000188843.1.42187 WP_000188843.1.42200 WP_000188843.1.42219 WP_000188843.1.4222 WP_000188843.1.42257 WP_000188843.1.42261 WP_000188843.1.42320 WP_000188843.1.42342 WP_000188843.1.42349 WP_000188843.1.42356 WP_000188843.1.42364 WP_000188843.1.42371 WP_000188843.1.42379 WP_000188843.1.4239 WP_000188843.1.42391 WP_000188843.1.42399 WP_000188843.1.42422 WP_000188843.1.42444 WP_000188843.1.42453 WP_000188843.1.42539 WP_000188843.1.42603 WP_000188843.1.42650 WP_000188843.1.4267 WP_000188843.1.42676 WP_000188843.1.42685 WP_000188843.1.42701 WP_000188843.1.42707 WP_000188843.1.4276 WP_000188843.1.42767 WP_000188843.1.42797 WP_000188843.1.42805 WP_000188843.1.42815 WP_000188843.1.42829 WP_000188843.1.42859 WP_000188843.1.42861 WP_000188843.1.42864 WP_000188843.1.4288 WP_000188843.1.42887 WP_000188843.1.4289 WP_000188843.1.42957 WP_000188843.1.4298 WP_000188843.1.43008 WP_000188843.1.43016 WP_000188843.1.43018 WP_000188843.1.43019 WP_000188843.1.43041 WP_000188843.1.43065 WP_000188843.1.43068 WP_000188843.1.43069 WP_000188843.1.43077 WP_000188843.1.43086 WP_000188843.1.43089 WP_000188843.1.43126 WP_000188843.1.43128 WP_000188843.1.43141 WP_000188843.1.43149 WP_000188843.1.43157 WP_000188843.1.43160 WP_000188843.1.43161 WP_000188843.1.43190 WP_000188843.1.43198 WP_000188843.1.43244 WP_000188843.1.4326 WP_000188843.1.43290 WP_000188843.1.43292 WP_000188843.1.43307 WP_000188843.1.43312 WP_000188843.1.43334 WP_000188843.1.43339 WP_000188843.1.43351 WP_000188843.1.43371 WP_000188843.1.43437 WP_000188843.1.43438 WP_000188843.1.43476 WP_000188843.1.43508 WP_000188843.1.43513 WP_000188843.1.43522 WP_000188843.1.43535 WP_000188843.1.43613 WP_000188843.1.43633 WP_000188843.1.43637 WP_000188843.1.43651 WP_000188843.1.43654 WP_000188843.1.43668 WP_000188843.1.43676 WP_000188843.1.43710 WP_000188843.1.43722 WP_000188843.1.4373 WP_000188843.1.43763 WP_000188843.1.43778 WP_000188843.1.43801 WP_000188843.1.43812 WP_000188843.1.43828 WP_000188843.1.43875 WP_000188843.1.43878 WP_000188843.1.43886 WP_000188843.1.43888 WP_000188843.1.43919 WP_000188843.1.43951 WP_000188843.1.43974 WP_000188843.1.44005 WP_000188843.1.4404 WP_000188843.1.44043 WP_000188843.1.44049 WP_000188843.1.4405 WP_000188843.1.44063 WP_000188843.1.44099 WP_000188843.1.44101 WP_000188843.1.44121 WP_000188843.1.44160 WP_000188843.1.44180 WP_000188843.1.44196 WP_000188843.1.4422 WP_000188843.1.4423 WP_000188843.1.44248 WP_000188843.1.44250 WP_000188843.1.44262 WP_000188843.1.44268 WP_000188843.1.4427 WP_000188843.1.44291 WP_000188843.1.44296 WP_000188843.1.44300 WP_000188843.1.44310 WP_000188843.1.44339 WP_000188843.1.44343 WP_000188843.1.44351 WP_000188843.1.44359 WP_000188843.1.44360 WP_000188843.1.44380 WP_000188843.1.44386 WP_000188843.1.4440 WP_000188843.1.44416 WP_000188843.1.44431 WP_000188843.1.44433 WP_000188843.1.44437 WP_000188843.1.44438 WP_000188843.1.44440 WP_000188843.1.44453 WP_000188843.1.44479 WP_000188843.1.44546 WP_000188843.1.44549 WP_000188843.1.44607 WP_000188843.1.44636 WP_000188843.1.44640 WP_000188843.1.4467 WP_000188843.1.4468 WP_000188843.1.44747 WP_000188843.1.44762 WP_000188843.1.44781 WP_000188843.1.44791 WP_000188843.1.44795 WP_000188843.1.44815 WP_000188843.1.44828 WP_000188843.1.4485 WP_000188843.1.44877 WP_000188843.1.44879 WP_000188843.1.44917 WP_000188843.1.44927 WP_000188843.1.44933 WP_000188843.1.44971 WP_000188843.1.4501 WP_000188843.1.45038 WP_000188843.1.45067 WP_000188843.1.45072 WP_000188843.1.45074 WP_000188843.1.45079 WP_000188843.1.45093 WP_000188843.1.45098 WP_000188843.1.45134 WP_000188843.1.45136 WP_000188843.1.45138 WP_000188843.1.45145 WP_000188843.1.45154 WP_000188843.1.45177 WP_000188843.1.45184 WP_000188843.1.45241 WP_000188843.1.45251 WP_000188843.1.45259 WP_000188843.1.45268 WP_000188843.1.45344 WP_000188843.1.45349 WP_000188843.1.45351 WP_000188843.1.45365 WP_000188843.1.45434 WP_000188843.1.45435 WP_000188843.1.45462 WP_000188843.1.45468 WP_000188843.1.45523 WP_000188843.1.45550 WP_000188843.1.45566 WP_000188843.1.45582 WP_000188843.1.45585 WP_000188843.1.45596 WP_000188843.1.45622 WP_000188843.1.45648 WP_000188843.1.45660 WP_000188843.1.45690 WP_000188843.1.45797 WP_000188843.1.458 WP_000188843.1.45829 WP_000188843.1.45848 WP_000188843.1.45871 WP_000188843.1.45984 WP_000188843.1.46011 WP_000188843.1.46028 WP_000188843.1.46030 WP_000188843.1.46069 WP_000188843.1.46077 WP_000188843.1.46091 WP_000188843.1.46112 WP_000188843.1.46169 WP_000188843.1.46173 WP_000188843.1.46174 WP_000188843.1.46187 WP_000188843.1.46225 WP_000188843.1.46232 WP_000188843.1.46241 WP_000188843.1.46250 WP_000188843.1.46278 WP_000188843.1.46286 WP_000188843.1.46299 WP_000188843.1.46303 WP_000188843.1.46307 WP_000188843.1.46322 WP_000188843.1.46355 WP_000188843.1.46358 WP_000188843.1.464 WP_000188843.1.46434 WP_000188843.1.46454 WP_000188843.1.46461 WP_000188843.1.46504 WP_000188843.1.46505 WP_000188843.1.46551 WP_000188843.1.46559 WP_000188843.1.46574 WP_000188843.1.46595 WP_000188843.1.46620 WP_000188843.1.46637 WP_000188843.1.46666 WP_000188843.1.46675 WP_000188843.1.46701 WP_000188843.1.46730 WP_000188843.1.46732 WP_000188843.1.46749 WP_000188843.1.46781 WP_000188843.1.46816 WP_000188843.1.46842 WP_000188843.1.4690 WP_000188843.1.46920 WP_000188843.1.46930 WP_000188843.1.46945 WP_000188843.1.46961 WP_000188843.1.47005 WP_000188843.1.47008 WP_000188843.1.47014 WP_000188843.1.47036 WP_000188843.1.47037 WP_000188843.1.47042 WP_000188843.1.47057 WP_000188843.1.47059 WP_000188843.1.47067 WP_000188843.1.47085 WP_000188843.1.47123 WP_000188843.1.47214 WP_000188843.1.47215 WP_000188843.1.47245 WP_000188843.1.47257 WP_000188843.1.47429 WP_000188843.1.47448 WP_000188843.1.47460 WP_000188843.1.4747 WP_000188843.1.47472 WP_000188843.1.47478 WP_000188843.1.47523 WP_000188843.1.47531 WP_000188843.1.47532 WP_000188843.1.47579 WP_000188843.1.47605 WP_000188843.1.47614 WP_000188843.1.47621 WP_000188843.1.47630 WP_000188843.1.47649 WP_000188843.1.4769 WP_000188843.1.47714 WP_000188843.1.4774 WP_000188843.1.4775 WP_000188843.1.47756 WP_000188843.1.47767 WP_000188843.1.47799 WP_000188843.1.4781 WP_000188843.1.47814 WP_000188843.1.47849 WP_000188843.1.47886 WP_000188843.1.47898 WP_000188843.1.47928 WP_000188843.1.48019 WP_000188843.1.48100 WP_000188843.1.48114 WP_000188843.1.48139 WP_000188843.1.48190 WP_000188843.1.48209 WP_000188843.1.48242 WP_000188843.1.48244 WP_000188843.1.48253 WP_000188843.1.48262 WP_000188843.1.48292 WP_000188843.1.483 WP_000188843.1.48324 WP_000188843.1.48367 WP_000188843.1.48377 WP_000188843.1.48399 WP_000188843.1.48426 WP_000188843.1.48430 WP_000188843.1.48436 WP_000188843.1.48455 WP_000188843.1.4853 WP_000188843.1.48570 WP_000188843.1.48586 WP_000188843.1.4859 WP_000188843.1.48591 WP_000188843.1.48610 WP_000188843.1.48631 WP_000188843.1.48651 WP_000188843.1.48663 WP_000188843.1.48690 WP_000188843.1.48734 WP_000188843.1.48751 WP_000188843.1.48756 WP_000188843.1.48778 WP_000188843.1.48788 WP_000188843.1.48849 WP_000188843.1.4885 WP_000188843.1.48876 WP_000188843.1.48886 WP_000188843.1.48894 WP_000188843.1.48896 WP_000188843.1.48919 WP_000188843.1.48955 WP_000188843.1.48963 WP_000188843.1.48973 WP_000188843.1.48985 WP_000188843.1.49004 WP_000188843.1.49084 WP_000188843.1.49090 WP_000188843.1.49102 WP_000188843.1.49106 WP_000188843.1.49113 WP_000188843.1.49117 WP_000188843.1.49121 WP_000188843.1.4914 WP_000188843.1.49140 WP_000188843.1.49153 WP_000188843.1.49155 WP_000188843.1.49162 WP_000188843.1.49166 WP_000188843.1.49204 WP_000188843.1.49214 WP_000188843.1.49226 WP_000188843.1.49239 WP_000188843.1.49256 WP_000188843.1.49276 WP_000188843.1.49290 WP_000188843.1.49304 WP_000188843.1.49340 WP_000188843.1.49355 WP_000188843.1.49366 WP_000188843.1.49429 WP_000188843.1.49434 WP_000188843.1.49450 WP_000188843.1.49472 WP_000188843.1.49490 WP_000188843.1.495 WP_000188843.1.49515 WP_000188843.1.49545 WP_000188843.1.49572 WP_000188843.1.49595 WP_000188843.1.49630 WP_000188843.1.49650 WP_000188843.1.49686 WP_000188843.1.49703 WP_000188843.1.49769 WP_000188843.1.4979 WP_000188843.1.49803 WP_000188843.1.49805 WP_000188843.1.49846 WP_000188843.1.49848 WP_000188843.1.4991 WP_000188843.1.49929 WP_000188843.1.49931 WP_000188843.1.49947 WP_000188843.1.49959 WP_000188843.1.49997 WP_000188843.1.50007 WP_000188843.1.50014 WP_000188843.1.50030 WP_000188843.1.50043 WP_000188843.1.50080 WP_000188843.1.5009 WP_000188843.1.50103 WP_000188843.1.50158 WP_000188843.1.50161 WP_000188843.1.50198 WP_000188843.1.50211 WP_000188843.1.50239 WP_000188843.1.50247 WP_000188843.1.50308 WP_000188843.1.50309 WP_000188843.1.50349 WP_000188843.1.50374 WP_000188843.1.50376 WP_000188843.1.50387 WP_000188843.1.50389 WP_000188843.1.50404 WP_000188843.1.50406 WP_000188843.1.50413 WP_000188843.1.50468 WP_000188843.1.50469 WP_000188843.1.5051 WP_000188843.1.50563 WP_000188843.1.50565 WP_000188843.1.50566 WP_000188843.1.50570 WP_000188843.1.50576 WP_000188843.1.50626 WP_000188843.1.50676 WP_000188843.1.50726 WP_000188843.1.50771 WP_000188843.1.50774 WP_000188843.1.50804 WP_000188843.1.50808 WP_000188843.1.50875 WP_000188843.1.5088 WP_000188843.1.50885 WP_000188843.1.509 WP_000188843.1.50908 WP_000188843.1.50929 WP_000188843.1.50941 WP_000188843.1.50970 WP_000188843.1.50999 WP_000188843.1.51014 WP_000188843.1.51022 WP_000188843.1.51025 WP_000188843.1.51036 WP_000188843.1.51040 WP_000188843.1.51048 WP_000188843.1.51066 WP_000188843.1.51100 WP_000188843.1.51134 WP_000188843.1.5114 WP_000188843.1.51162 WP_000188843.1.51179 WP_000188843.1.51182 WP_000188843.1.51186 WP_000188843.1.51224 WP_000188843.1.51227 WP_000188843.1.5125 WP_000188843.1.5127 WP_000188843.1.51305 WP_000188843.1.51315 WP_000188843.1.5136 WP_000188843.1.5138 WP_000188843.1.51394 WP_000188843.1.51414 WP_000188843.1.51464 WP_000188843.1.51474 WP_000188843.1.51487 WP_000188843.1.51488 WP_000188843.1.51519 WP_000188843.1.51555 WP_000188843.1.51594 WP_000188843.1.51598 WP_000188843.1.51611 WP_000188843.1.51613 WP_000188843.1.51634 WP_000188843.1.51644 WP_000188843.1.51649 WP_000188843.1.51686 WP_000188843.1.51700 WP_000188843.1.51704 WP_000188843.1.51724 WP_000188843.1.51734 WP_000188843.1.51756 WP_000188843.1.51831 WP_000188843.1.51838 WP_000188843.1.51841 WP_000188843.1.51863 WP_000188843.1.51888 WP_000188843.1.51900 WP_000188843.1.51910 WP_000188843.1.51911 WP_000188843.1.51932 WP_000188843.1.51935 WP_000188843.1.51989 WP_000188843.1.52057 WP_000188843.1.52114 WP_000188843.1.52121 WP_000188843.1.52123 WP_000188843.1.52129 WP_000188843.1.52148 WP_000188843.1.52156 WP_000188843.1.5216 WP_000188843.1.52161 WP_000188843.1.52170 WP_000188843.1.52191 WP_000188843.1.52202 WP_000188843.1.52209 WP_000188843.1.52255 WP_000188843.1.52336 WP_000188843.1.52339 WP_000188843.1.52346 WP_000188843.1.52353 WP_000188843.1.52361 WP_000188843.1.52438 WP_000188843.1.52446 WP_000188843.1.52456 WP_000188843.1.52469 WP_000188843.1.52571 WP_000188843.1.526 WP_000188843.1.52637 WP_000188843.1.52647 WP_000188843.1.52653 WP_000188843.1.52656 WP_000188843.1.52675 WP_000188843.1.52692 WP_000188843.1.5273 WP_000188843.1.52738 WP_000188843.1.52742 WP_000188843.1.52743 WP_000188843.1.52773 WP_000188843.1.52795 WP_000188843.1.52807 WP_000188843.1.52857 WP_000188843.1.52866 WP_000188843.1.52887 WP_000188843.1.52898 WP_000188843.1.52915 WP_000188843.1.52949 WP_000188843.1.52985 WP_000188843.1.53092 WP_000188843.1.53141 WP_000188843.1.53151 WP_000188843.1.53154 WP_000188843.1.53159 WP_000188843.1.53179 WP_000188843.1.53190 WP_000188843.1.53210 WP_000188843.1.53233 WP_000188843.1.53272 WP_000188843.1.53307 WP_000188843.1.53315 WP_000188843.1.53321 WP_000188843.1.53328 WP_000188843.1.5333 WP_000188843.1.53368 WP_000188843.1.53375 WP_000188843.1.53406 WP_000188843.1.53436 WP_000188843.1.53450 WP_000188843.1.53454 WP_000188843.1.53466 WP_000188843.1.5349 WP_000188843.1.53529 WP_000188843.1.53540 WP_000188843.1.53543 WP_000188843.1.53555 WP_000188843.1.53559 WP_000188843.1.5356 WP_000188843.1.53571 WP_000188843.1.5358 WP_000188843.1.53688 WP_000188843.1.53692 WP_000188843.1.53694 WP_000188843.1.53723 WP_000188843.1.5374 WP_000188843.1.53750 WP_000188843.1.53757 WP_000188843.1.53790 WP_000188843.1.53800 WP_000188843.1.53812 WP_000188843.1.53814 WP_000188843.1.53815 WP_000188843.1.53839 WP_000188843.1.53892 WP_000188843.1.53898 WP_000188843.1.53902 WP_000188843.1.53905 WP_000188843.1.5392 WP_000188843.1.53935 WP_000188843.1.53958 WP_000188843.1.53981 WP_000188843.1.53984 WP_000188843.1.54033 WP_000188843.1.54061 WP_000188843.1.54075 WP_000188843.1.54082 WP_000188843.1.54085 WP_000188843.1.54132 WP_000188843.1.5415 WP_000188843.1.54170 WP_000188843.1.54175 WP_000188843.1.54196 WP_000188843.1.542 WP_000188843.1.54203 WP_000188843.1.54209 WP_000188843.1.54259 WP_000188843.1.54271 WP_000188843.1.54273 WP_000188843.1.54274 WP_000188843.1.5430 WP_000188843.1.54319 WP_000188843.1.54324 WP_000188843.1.54364 WP_000188843.1.54371 WP_000188843.1.54400 WP_000188843.1.54431 WP_000188843.1.54442 WP_000188843.1.54482 WP_000188843.1.54500 WP_000188843.1.54526 WP_000188843.1.54558 WP_000188843.1.54569 WP_000188843.1.54589 WP_000188843.1.54644 WP_000188843.1.54662 WP_000188843.1.54667 WP_000188843.1.54678 WP_000188843.1.54681 WP_000188843.1.54694 WP_000188843.1.54722 WP_000188843.1.54748 WP_000188843.1.54749 WP_000188843.1.54764 WP_000188843.1.5481 WP_000188843.1.54865 WP_000188843.1.54935 WP_000188843.1.54979 WP_000188843.1.55008 WP_000188843.1.55010 WP_000188843.1.55034 WP_000188843.1.55152 WP_000188843.1.55156 WP_000188843.1.55163 WP_000188843.1.55165 WP_000188843.1.55166 WP_000188843.1.5517 WP_000188843.1.55178 WP_000188843.1.55215 WP_000188843.1.55223 WP_000188843.1.5523 WP_000188843.1.55285 WP_000188843.1.55290 WP_000188843.1.55310 WP_000188843.1.55317 WP_000188843.1.55325 WP_000188843.1.55379 WP_000188843.1.5539 WP_000188843.1.55430 WP_000188843.1.55468 WP_000188843.1.55475 WP_000188843.1.55506 WP_000188843.1.5552 WP_000188843.1.55528 WP_000188843.1.5555 WP_000188843.1.5560 WP_000188843.1.55604 WP_000188843.1.55623 WP_000188843.1.55639 WP_000188843.1.55647 WP_000188843.1.55699 WP_000188843.1.55725 WP_000188843.1.55743 WP_000188843.1.55768 WP_000188843.1.55780 WP_000188843.1.55782 WP_000188843.1.55796 WP_000188843.1.55803 WP_000188843.1.55967 WP_000188843.1.55973 WP_000188843.1.55993 WP_000188843.1.55995 WP_000188843.1.56002 WP_000188843.1.56004 WP_000188843.1.56012 WP_000188843.1.56097 WP_000188843.1.56105 WP_000188843.1.56130 WP_000188843.1.56144 WP_000188843.1.56172 WP_000188843.1.5621 WP_000188843.1.56222 WP_000188843.1.56226 WP_000188843.1.56238 WP_000188843.1.56244 WP_000188843.1.56247 WP_000188843.1.56261 WP_000188843.1.56303 WP_000188843.1.56304 WP_000188843.1.56305 WP_000188843.1.56311 WP_000188843.1.5633 WP_000188843.1.56370 WP_000188843.1.56393 WP_000188843.1.56396 WP_000188843.1.56413 WP_000188843.1.56414 WP_000188843.1.56419 WP_000188843.1.56420 WP_000188843.1.56423 WP_000188843.1.56438 WP_000188843.1.56514 WP_000188843.1.56535 WP_000188843.1.56559 WP_000188843.1.56560 WP_000188843.1.56585 WP_000188843.1.56597 WP_000188843.1.56601 WP_000188843.1.56614 WP_000188843.1.56615 WP_000188843.1.56640 WP_000188843.1.56642 WP_000188843.1.56651 WP_000188843.1.56660 WP_000188843.1.56671 WP_000188843.1.56682 WP_000188843.1.56724 WP_000188843.1.56824 WP_000188843.1.56825 WP_000188843.1.56853 WP_000188843.1.56875 WP_000188843.1.56877 WP_000188843.1.56887 WP_000188843.1.56889 WP_000188843.1.56893 WP_000188843.1.56981 WP_000188843.1.57076 WP_000188843.1.57084 WP_000188843.1.57101 WP_000188843.1.57137 WP_000188843.1.57147 WP_000188843.1.57149 WP_000188843.1.57168 WP_000188843.1.57179 WP_000188843.1.57186 WP_000188843.1.57187 WP_000188843.1.57232 WP_000188843.1.57307 WP_000188843.1.57342 WP_000188843.1.57344 WP_000188843.1.57356 WP_000188843.1.57357 WP_000188843.1.57377 WP_000188843.1.57399 WP_000188843.1.57418 WP_000188843.1.57433 WP_000188843.1.57495 WP_000188843.1.57515 WP_000188843.1.57529 WP_000188843.1.57534 WP_000188843.1.57576 WP_000188843.1.57601 WP_000188843.1.57607 WP_000188843.1.57684 WP_000188843.1.57699 WP_000188843.1.57710 WP_000188843.1.57735 WP_000188843.1.5774 WP_000188843.1.57763 WP_000188843.1.57785 WP_000188843.1.57800 WP_000188843.1.57862 WP_000188843.1.57873 WP_000188843.1.57890 WP_000188843.1.57891 WP_000188843.1.57965 WP_000188843.1.57972 WP_000188843.1.57978 WP_000188843.1.58008 WP_000188843.1.5801 WP_000188843.1.58040 WP_000188843.1.58041 WP_000188843.1.58044 WP_000188843.1.58081 WP_000188843.1.5809 WP_000188843.1.58131 WP_000188843.1.58132 WP_000188843.1.58144 WP_000188843.1.58173 WP_000188843.1.58191 WP_000188843.1.58194 WP_000188843.1.58239 WP_000188843.1.58249 WP_000188843.1.58251 WP_000188843.1.58252 WP_000188843.1.58261 WP_000188843.1.58274 WP_000188843.1.58282 WP_000188843.1.58301 WP_000188843.1.58324 WP_000188843.1.58326 WP_000188843.1.58358 WP_000188843.1.5836 WP_000188843.1.58407 WP_000188843.1.58416 WP_000188843.1.58418 WP_000188843.1.58442 WP_000188843.1.58485 WP_000188843.1.58537 WP_000188843.1.5854 WP_000188843.1.58548 WP_000188843.1.58564 WP_000188843.1.58568 WP_000188843.1.5858 WP_000188843.1.58583 WP_000188843.1.58652 WP_000188843.1.58662 WP_000188843.1.58663 WP_000188843.1.58669 WP_000188843.1.58698 WP_000188843.1.58724 WP_000188843.1.58744 WP_000188843.1.58745 WP_000188843.1.5875 WP_000188843.1.58796 WP_000188843.1.58803 WP_000188843.1.58807 WP_000188843.1.58831 WP_000188843.1.58836 WP_000188843.1.58847 WP_000188843.1.5886 WP_000188843.1.58883 WP_000188843.1.58898 WP_000188843.1.58949 WP_000188843.1.58963 WP_000188843.1.58970 WP_000188843.1.58974 WP_000188843.1.59006 WP_000188843.1.59012 WP_000188843.1.59020 WP_000188843.1.59043 WP_000188843.1.59056 WP_000188843.1.59061 WP_000188843.1.59064 WP_000188843.1.59094 WP_000188843.1.59125 WP_000188843.1.59136 WP_000188843.1.59224 WP_000188843.1.59282 WP_000188843.1.5929 WP_000188843.1.59299 WP_000188843.1.59313 WP_000188843.1.59321 WP_000188843.1.59336 WP_000188843.1.59375 WP_000188843.1.59381 WP_000188843.1.59420 WP_000188843.1.59458 WP_000188843.1.5949 WP_000188843.1.59490 WP_000188843.1.59501 WP_000188843.1.59508 WP_000188843.1.59510 WP_000188843.1.59521 WP_000188843.1.5953 WP_000188843.1.59641 WP_000188843.1.59684 WP_000188843.1.5969 WP_000188843.1.59694 WP_000188843.1.59710 WP_000188843.1.59751 WP_000188843.1.59771 WP_000188843.1.5979 WP_000188843.1.59827 WP_000188843.1.59829 WP_000188843.1.59830 WP_000188843.1.59847 WP_000188843.1.59863 WP_000188843.1.59928 WP_000188843.1.59953 WP_000188843.1.59969 WP_000188843.1.59979 WP_000188843.1.59994 WP_000188843.1.60008 WP_000188843.1.60021 WP_000188843.1.60045 WP_000188843.1.60052 WP_000188843.1.60069 WP_000188843.1.60076 WP_000188843.1.60114 WP_000188843.1.60140 WP_000188843.1.60154 WP_000188843.1.60155 WP_000188843.1.60168 WP_000188843.1.60192 WP_000188843.1.60199 WP_000188843.1.60212 WP_000188843.1.60226 WP_000188843.1.60253 WP_000188843.1.60285 WP_000188843.1.60322 WP_000188843.1.60324 WP_000188843.1.60330 WP_000188843.1.60356 WP_000188843.1.60370 WP_000188843.1.60379 WP_000188843.1.6038 WP_000188843.1.60380 WP_000188843.1.6041 WP_000188843.1.60424 WP_000188843.1.60464 WP_000188843.1.60481 WP_000188843.1.605 WP_000188843.1.60503 WP_000188843.1.60545 WP_000188843.1.60561 WP_000188843.1.6058 WP_000188843.1.60584 WP_000188843.1.6060 WP_000188843.1.60622 WP_000188843.1.60643 WP_000188843.1.60676 WP_000188843.1.60708 WP_000188843.1.60725 WP_000188843.1.60746 WP_000188843.1.60760 WP_000188843.1.60772 WP_000188843.1.60783 WP_000188843.1.60792 WP_000188843.1.60794 WP_000188843.1.60807 WP_000188843.1.60838 WP_000188843.1.60863 WP_000188843.1.60874 WP_000188843.1.60882 WP_000188843.1.60889 WP_000188843.1.60919 WP_000188843.1.60941 WP_000188843.1.60950 WP_000188843.1.60988 WP_000188843.1.60990 WP_000188843.1.6104 WP_000188843.1.61044 WP_000188843.1.61045 WP_000188843.1.61076 WP_000188843.1.61078 WP_000188843.1.61123 WP_000188843.1.6114 WP_000188843.1.61146 WP_000188843.1.61147 WP_000188843.1.61168 WP_000188843.1.61184 WP_000188843.1.61201 WP_000188843.1.61210 WP_000188843.1.61232 WP_000188843.1.61233 WP_000188843.1.6129 WP_000188843.1.61296 WP_000188843.1.61345 WP_000188843.1.61357 WP_000188843.1.61417 WP_000188843.1.61434 WP_000188843.1.61511 WP_000188843.1.61519 WP_000188843.1.61539 WP_000188843.1.61542 WP_000188843.1.61553 WP_000188843.1.61574 WP_000188843.1.61609 WP_000188843.1.6164 WP_000188843.1.61649 WP_000188843.1.61652 WP_000188843.1.61662 WP_000188843.1.61667 WP_000188843.1.61697 WP_000188843.1.61712 WP_000188843.1.61714 WP_000188843.1.61730 WP_000188843.1.61732 WP_000188843.1.61809 WP_000188843.1.61857 WP_000188843.1.61877 WP_000188843.1.61918 WP_000188843.1.61920 WP_000188843.1.61952 WP_000188843.1.62007 WP_000188843.1.62020 WP_000188843.1.62025 WP_000188843.1.6209 WP_000188843.1.6210 WP_000188843.1.62108 WP_000188843.1.62124 WP_000188843.1.62144 WP_000188843.1.62184 WP_000188843.1.62199 WP_000188843.1.62204 WP_000188843.1.62219 WP_000188843.1.62223 WP_000188843.1.62241 WP_000188843.1.62257 WP_000188843.1.62302 WP_000188843.1.62304 WP_000188843.1.62310 WP_000188843.1.62314 WP_000188843.1.62323 WP_000188843.1.62333 WP_000188843.1.62338 WP_000188843.1.62344 WP_000188843.1.62364 WP_000188843.1.62374 WP_000188843.1.62380 WP_000188843.1.62403 WP_000188843.1.62411 WP_000188843.1.62436 WP_000188843.1.62475 WP_000188843.1.62486 WP_000188843.1.6253 WP_000188843.1.62536 WP_000188843.1.62570 WP_000188843.1.62640 WP_000188843.1.62686 WP_000188843.1.62693 WP_000188843.1.62725 WP_000188843.1.62751 WP_000188843.1.62798 WP_000188843.1.62825 WP_000188843.1.62828 WP_000188843.1.62903 WP_000188843.1.62910 WP_000188843.1.62913 WP_000188843.1.62932 WP_000188843.1.62955 WP_000188843.1.62960 WP_000188843.1.63016 WP_000188843.1.63025 WP_000188843.1.63063 WP_000188843.1.63069 WP_000188843.1.63087 WP_000188843.1.63118 WP_000188843.1.63135 WP_000188843.1.63155 WP_000188843.1.63169 WP_000188843.1.63181 WP_000188843.1.63203 WP_000188843.1.63234 WP_000188843.1.63243 WP_000188843.1.63250 WP_000188843.1.63256 WP_000188843.1.63290 WP_000188843.1.63297 WP_000188843.1.63382 WP_000188843.1.63422 WP_000188843.1.63432 WP_000188843.1.63448 WP_000188843.1.63461 WP_000188843.1.63479 WP_000188843.1.63514 WP_000188843.1.63525 WP_000188843.1.63532 WP_000188843.1.63568 WP_000188843.1.63577 WP_000188843.1.63583 WP_000188843.1.63592 WP_000188843.1.63633 WP_000188843.1.63663 WP_000188843.1.63664 WP_000188843.1.6367 WP_000188843.1.63677 WP_000188843.1.63690 WP_000188843.1.63718 WP_000188843.1.63731 WP_000188843.1.63736 WP_000188843.1.6375 WP_000188843.1.63757 WP_000188843.1.63766 WP_000188843.1.63782 WP_000188843.1.63797 WP_000188843.1.63816 WP_000188843.1.63824 WP_000188843.1.63834 WP_000188843.1.63860 WP_000188843.1.63864 WP_000188843.1.63866 WP_000188843.1.63876 WP_000188843.1.6389 WP_000188843.1.63901 WP_000188843.1.63912 WP_000188843.1.63934 WP_000188843.1.63955 WP_000188843.1.63958 WP_000188843.1.63963 WP_000188843.1.63992 WP_000188843.1.64007 WP_000188843.1.64018 WP_000188843.1.64032 WP_000188843.1.64046 WP_000188843.1.64072 WP_000188843.1.64087 WP_000188843.1.6415 WP_000188843.1.64208 WP_000188843.1.64217 WP_000188843.1.6423 WP_000188843.1.64242 WP_000188843.1.64244 WP_000188843.1.64293 WP_000188843.1.64332 WP_000188843.1.64374 WP_000188843.1.64376 WP_000188843.1.64387 WP_000188843.1.644 WP_000188843.1.64403 WP_000188843.1.64471 WP_000188843.1.64501 WP_000188843.1.6451 WP_000188843.1.64538 WP_000188843.1.64569 WP_000188843.1.64632 WP_000188843.1.64645 WP_000188843.1.64648 WP_000188843.1.64649 WP_000188843.1.64654 WP_000188843.1.64662 WP_000188843.1.64663 WP_000188843.1.64667 WP_000188843.1.64702 WP_000188843.1.64709 WP_000188843.1.64710 WP_000188843.1.64744 WP_000188843.1.64757 WP_000188843.1.64763 WP_000188843.1.64781 WP_000188843.1.64798 WP_000188843.1.64817 WP_000188843.1.64831 WP_000188843.1.64847 WP_000188843.1.6487 WP_000188843.1.6489 WP_000188843.1.64891 WP_000188843.1.64894 WP_000188843.1.64920 WP_000188843.1.64944 WP_000188843.1.64974 WP_000188843.1.65016 WP_000188843.1.65018 WP_000188843.1.65027 WP_000188843.1.65028 WP_000188843.1.65054 WP_000188843.1.65075 WP_000188843.1.6514 WP_000188843.1.65163 WP_000188843.1.65168 WP_000188843.1.65171 WP_000188843.1.65172 WP_000188843.1.65191 WP_000188843.1.65200 WP_000188843.1.65211 WP_000188843.1.65218 WP_000188843.1.65226 WP_000188843.1.65238 WP_000188843.1.65248 WP_000188843.1.65249 WP_000188843.1.65266 WP_000188843.1.65269 WP_000188843.1.6535 WP_000188843.1.65394 WP_000188843.1.65395 WP_000188843.1.65459 WP_000188843.1.65463 WP_000188843.1.65474 WP_000188843.1.65487 WP_000188843.1.6549 WP_000188843.1.65499 WP_000188843.1.6550 WP_000188843.1.65508 WP_000188843.1.6554 WP_000188843.1.65572 WP_000188843.1.6561 WP_000188843.1.65633 WP_000188843.1.6565 WP_000188843.1.65650 WP_000188843.1.65696 WP_000188843.1.65697 WP_000188843.1.65699 WP_000188843.1.65737 WP_000188843.1.6575 WP_000188843.1.65755 WP_000188843.1.65782 WP_000188843.1.65812 WP_000188843.1.65838 WP_000188843.1.65846 WP_000188843.1.65849 WP_000188843.1.65863 WP_000188843.1.6594 WP_000188843.1.65940 WP_000188843.1.65956 WP_000188843.1.65985 WP_000188843.1.66021 WP_000188843.1.66031 WP_000188843.1.66049 WP_000188843.1.66052 WP_000188843.1.66064 WP_000188843.1.66074 WP_000188843.1.66109 WP_000188843.1.66129 WP_000188843.1.66145 WP_000188843.1.66167 WP_000188843.1.66183 WP_000188843.1.6620 WP_000188843.1.66216 WP_000188843.1.66234 WP_000188843.1.66270 WP_000188843.1.66273 WP_000188843.1.6630 WP_000188843.1.66314 WP_000188843.1.66324 WP_000188843.1.66330 WP_000188843.1.6634 WP_000188843.1.66358 WP_000188843.1.66361 WP_000188843.1.66362 WP_000188843.1.66365 WP_000188843.1.6638 WP_000188843.1.6640 WP_000188843.1.6647 WP_000188843.1.66480 WP_000188843.1.66492 WP_000188843.1.66506 WP_000188843.1.66534 WP_000188843.1.66600 WP_000188843.1.66630 WP_000188843.1.66665 WP_000188843.1.66678 WP_000188843.1.66681 WP_000188843.1.66684 WP_000188843.1.66698 WP_000188843.1.66755 WP_000188843.1.66759 WP_000188843.1.66801 WP_000188843.1.66807 WP_000188843.1.66834 WP_000188843.1.66860 WP_000188843.1.66901 WP_000188843.1.66953 WP_000188843.1.66955 WP_000188843.1.66962 WP_000188843.1.66981 WP_000188843.1.67024 WP_000188843.1.67037 WP_000188843.1.67042 WP_000188843.1.67045 WP_000188843.1.67100 WP_000188843.1.67101 WP_000188843.1.67143 WP_000188843.1.67175 WP_000188843.1.67181 WP_000188843.1.67184 WP_000188843.1.67201 WP_000188843.1.67211 WP_000188843.1.67235 WP_000188843.1.67237 WP_000188843.1.67268 WP_000188843.1.67288 WP_000188843.1.67336 WP_000188843.1.67339 WP_000188843.1.67347 WP_000188843.1.67374 WP_000188843.1.67387 WP_000188843.1.6739 WP_000188843.1.67394 WP_000188843.1.67397 WP_000188843.1.67403 WP_000188843.1.67430 WP_000188843.1.67442 WP_000188843.1.67465 WP_000188843.1.67539 WP_000188843.1.67552 WP_000188843.1.67556 WP_000188843.1.67576 WP_000188843.1.67603 WP_000188843.1.67604 WP_000188843.1.67619 WP_000188843.1.67625 WP_000188843.1.67627 WP_000188843.1.67641 WP_000188843.1.67657 WP_000188843.1.67673 WP_000188843.1.67682 WP_000188843.1.67700 WP_000188843.1.67718 WP_000188843.1.67729 WP_000188843.1.67772 WP_000188843.1.67774 WP_000188843.1.67814 WP_000188843.1.67820 WP_000188843.1.67829 WP_000188843.1.6785 WP_000188843.1.67887 WP_000188843.1.67910 WP_000188843.1.67942 WP_000188843.1.67954 WP_000188843.1.67969 WP_000188843.1.68 WP_000188843.1.68036 WP_000188843.1.68043 WP_000188843.1.68073 WP_000188843.1.68105 WP_000188843.1.68113 WP_000188843.1.68131 WP_000188843.1.68182 WP_000188843.1.6819 WP_000188843.1.68201 WP_000188843.1.68206 WP_000188843.1.6827 WP_000188843.1.68275 WP_000188843.1.68285 WP_000188843.1.6833 WP_000188843.1.68359 WP_000188843.1.68401 WP_000188843.1.68420 WP_000188843.1.68477 WP_000188843.1.68478 WP_000188843.1.6849 WP_000188843.1.68514 WP_000188843.1.68532 WP_000188843.1.68547 WP_000188843.1.68564 WP_000188843.1.6857 WP_000188843.1.6858 WP_000188843.1.68589 WP_000188843.1.68591 WP_000188843.1.68655 WP_000188843.1.68656 WP_000188843.1.68658 WP_000188843.1.68688 WP_000188843.1.6869 WP_000188843.1.68742 WP_000188843.1.6875 WP_000188843.1.68770 WP_000188843.1.68778 WP_000188843.1.68787 WP_000188843.1.68809 WP_000188843.1.68818 WP_000188843.1.68894 WP_000188843.1.68914 WP_000188843.1.68928 WP_000188843.1.68966 WP_000188843.1.68975 WP_000188843.1.69001 WP_000188843.1.69006 WP_000188843.1.69029 WP_000188843.1.6904 WP_000188843.1.69053 WP_000188843.1.69058 WP_000188843.1.6913 WP_000188843.1.69146 WP_000188843.1.69151 WP_000188843.1.69170 WP_000188843.1.69210 WP_000188843.1.69255 WP_000188843.1.69270 WP_000188843.1.69282 WP_000188843.1.69288 WP_000188843.1.69296 WP_000188843.1.69320 WP_000188843.1.69359 WP_000188843.1.69371 WP_000188843.1.69376 WP_000188843.1.69385 WP_000188843.1.69396 WP_000188843.1.69397 WP_000188843.1.69465 WP_000188843.1.69466 WP_000188843.1.6954 WP_000188843.1.69554 WP_000188843.1.69564 WP_000188843.1.69611 WP_000188843.1.69636 WP_000188843.1.69642 WP_000188843.1.69644 WP_000188843.1.69656 WP_000188843.1.69657 WP_000188843.1.69690 WP_000188843.1.69704 WP_000188843.1.69754 WP_000188843.1.69758 WP_000188843.1.69787 WP_000188843.1.69807 WP_000188843.1.69923 WP_000188843.1.69948 WP_000188843.1.69953 WP_000188843.1.69977 WP_000188843.1.70003 WP_000188843.1.70010 WP_000188843.1.70028 WP_000188843.1.70049 WP_000188843.1.70058 WP_000188843.1.70061 WP_000188843.1.7010 WP_000188843.1.7014 WP_000188843.1.70169 WP_000188843.1.70183 WP_000188843.1.70205 WP_000188843.1.7021 WP_000188843.1.70240 WP_000188843.1.70241 WP_000188843.1.70248 WP_000188843.1.70249 WP_000188843.1.70261 WP_000188843.1.70269 WP_000188843.1.70281 WP_000188843.1.70289 WP_000188843.1.70290 WP_000188843.1.70314 WP_000188843.1.70321 WP_000188843.1.70326 WP_000188843.1.70327 WP_000188843.1.7033 WP_000188843.1.70355 WP_000188843.1.70427 WP_000188843.1.70433 WP_000188843.1.7044 WP_000188843.1.70447 WP_000188843.1.70488 WP_000188843.1.70523 WP_000188843.1.70545 WP_000188843.1.70547 WP_000188843.1.70580 WP_000188843.1.70623 WP_000188843.1.70643 WP_000188843.1.70671 WP_000188843.1.70679 WP_000188843.1.70683 WP_000188843.1.70708 WP_000188843.1.70712 WP_000188843.1.70717 WP_000188843.1.70731 WP_000188843.1.70733 WP_000188843.1.70761 WP_000188843.1.70772 WP_000188843.1.70792 WP_000188843.1.70845 WP_000188843.1.70846 WP_000188843.1.70883 WP_000188843.1.70899 WP_000188843.1.70914 WP_000188843.1.70922 WP_000188843.1.7093 WP_000188843.1.70948 WP_000188843.1.70959 WP_000188843.1.70969 WP_000188843.1.70971 WP_000188843.1.70981 WP_000188843.1.70986 WP_000188843.1.70995 WP_000188843.1.71023 WP_000188843.1.71039 WP_000188843.1.71057 WP_000188843.1.71081 WP_000188843.1.7110 WP_000188843.1.71116 WP_000188843.1.71117 WP_000188843.1.71146 WP_000188843.1.71165 WP_000188843.1.71186 WP_000188843.1.71188 WP_000188843.1.71202 WP_000188843.1.71243 WP_000188843.1.71248 WP_000188843.1.71306 WP_000188843.1.71337 WP_000188843.1.7134 WP_000188843.1.71363 WP_000188843.1.71368 WP_000188843.1.71378 WP_000188843.1.714 WP_000188843.1.71401 WP_000188843.1.7142 WP_000188843.1.71446 WP_000188843.1.71450 WP_000188843.1.71455 WP_000188843.1.71456 WP_000188843.1.71481 WP_000188843.1.71487 WP_000188843.1.71523 WP_000188843.1.71542 WP_000188843.1.71566 WP_000188843.1.71583 WP_000188843.1.71636 WP_000188843.1.71640 WP_000188843.1.71651 WP_000188843.1.71653 WP_000188843.1.71691 WP_000188843.1.71702 WP_000188843.1.71716 WP_000188843.1.7174 WP_000188843.1.71746 WP_000188843.1.71750 WP_000188843.1.71756 WP_000188843.1.71798 WP_000188843.1.71845 WP_000188843.1.71872 WP_000188843.1.71881 WP_000188843.1.71908 WP_000188843.1.71929 WP_000188843.1.71941 WP_000188843.1.71950 WP_000188843.1.71952 WP_000188843.1.71954 WP_000188843.1.71973 WP_000188843.1.71985 WP_000188843.1.72003 WP_000188843.1.72065 WP_000188843.1.72073 WP_000188843.1.72105 WP_000188843.1.72119 WP_000188843.1.72203 WP_000188843.1.72226 WP_000188843.1.72234 WP_000188843.1.72243 WP_000188843.1.72269 WP_000188843.1.72350 WP_000188843.1.72372 WP_000188843.1.72376 WP_000188843.1.72383 WP_000188843.1.72403 WP_000188843.1.72461 WP_000188843.1.72527 WP_000188843.1.7255 WP_000188843.1.72594 WP_000188843.1.72629 WP_000188843.1.72631 WP_000188843.1.72638 WP_000188843.1.72667 WP_000188843.1.72671 WP_000188843.1.72674 WP_000188843.1.72689 WP_000188843.1.72724 WP_000188843.1.72728 WP_000188843.1.72789 WP_000188843.1.72793 WP_000188843.1.72828 WP_000188843.1.72843 WP_000188843.1.72850 WP_000188843.1.72871 WP_000188843.1.72872 WP_000188843.1.72896 WP_000188843.1.72897 WP_000188843.1.72969 WP_000188843.1.72975 WP_000188843.1.72987 WP_000188843.1.7304 WP_000188843.1.73052 WP_000188843.1.73062 WP_000188843.1.7311 WP_000188843.1.73114 WP_000188843.1.73125 WP_000188843.1.73144 WP_000188843.1.7315 WP_000188843.1.73177 WP_000188843.1.73180 WP_000188843.1.73200 WP_000188843.1.73258 WP_000188843.1.73285 WP_000188843.1.7332 WP_000188843.1.7333 WP_000188843.1.7334 WP_000188843.1.73352 WP_000188843.1.73377 WP_000188843.1.73389 WP_000188843.1.73425 WP_000188843.1.73461 WP_000188843.1.73481 WP_000188843.1.73488 WP_000188843.1.73504 WP_000188843.1.7353 WP_000188843.1.73535 WP_000188843.1.73544 WP_000188843.1.7356 WP_000188843.1.73561 WP_000188843.1.73581 WP_000188843.1.73598 WP_000188843.1.7361 WP_000188843.1.73617 WP_000188843.1.73648 WP_000188843.1.73667 WP_000188843.1.73669 WP_000188843.1.73753 WP_000188843.1.73758 WP_000188843.1.73768 WP_000188843.1.73794 WP_000188843.1.73804 WP_000188843.1.73831 WP_000188843.1.73847 WP_000188843.1.73849 WP_000188843.1.7387 WP_000188843.1.73924 WP_000188843.1.73926 WP_000188843.1.73948 WP_000188843.1.73956 WP_000188843.1.73999 WP_000188843.1.74024 WP_000188843.1.74029 WP_000188843.1.74030 WP_000188843.1.74038 WP_000188843.1.74040 WP_000188843.1.74043 WP_000188843.1.74058 WP_000188843.1.74070 WP_000188843.1.74077 WP_000188843.1.74089 WP_000188843.1.74135 WP_000188843.1.74181 WP_000188843.1.74191 WP_000188843.1.74214 WP_000188843.1.74241 WP_000188843.1.74285 WP_000188843.1.7430 WP_000188843.1.74317 WP_000188843.1.7433 WP_000188843.1.74379 WP_000188843.1.74410 WP_000188843.1.74414 WP_000188843.1.74415 WP_000188843.1.74422 WP_000188843.1.7444 WP_000188843.1.74454 WP_000188843.1.74466 WP_000188843.1.74469 WP_000188843.1.74481 WP_000188843.1.745 WP_000188843.1.74529 WP_000188843.1.74545 WP_000188843.1.74616 WP_000188843.1.74621 WP_000188843.1.74644 WP_000188843.1.74647 WP_000188843.1.74677 WP_000188843.1.74699 WP_000188843.1.74702 WP_000188843.1.74745 WP_000188843.1.74806 WP_000188843.1.74831 WP_000188843.1.74876 WP_000188843.1.74894 WP_000188843.1.7491 WP_000188843.1.74929 WP_000188843.1.74939 WP_000188843.1.74973 WP_000188843.1.74996 WP_000188843.1.7507 WP_000188843.1.75089 WP_000188843.1.75116 WP_000188843.1.75129 WP_000188843.1.75134 WP_000188843.1.75168 WP_000188843.1.75177 WP_000188843.1.75187 WP_000188843.1.75237 WP_000188843.1.75273 WP_000188843.1.75288 WP_000188843.1.75296 WP_000188843.1.75301 WP_000188843.1.7531 WP_000188843.1.75334 WP_000188843.1.75362 WP_000188843.1.75385 WP_000188843.1.75392 WP_000188843.1.75402 WP_000188843.1.75413 WP_000188843.1.75433 WP_000188843.1.75532 WP_000188843.1.75565 WP_000188843.1.75593 WP_000188843.1.75610 WP_000188843.1.75633 WP_000188843.1.75718 WP_000188843.1.75740 WP_000188843.1.75745 WP_000188843.1.75760 WP_000188843.1.75764 WP_000188843.1.75793 WP_000188843.1.75828 WP_000188843.1.75837 WP_000188843.1.75844 WP_000188843.1.75874 WP_000188843.1.75884 WP_000188843.1.75886 WP_000188843.1.75898 WP_000188843.1.75932 WP_000188843.1.75945 WP_000188843.1.75957 WP_000188843.1.76020 WP_000188843.1.76024 WP_000188843.1.76055 WP_000188843.1.76081 WP_000188843.1.76097 WP_000188843.1.76102 WP_000188843.1.76116 WP_000188843.1.76122 WP_000188843.1.76156 WP_000188843.1.76170 WP_000188843.1.76208 WP_000188843.1.76252 WP_000188843.1.76256 WP_000188843.1.76327 WP_000188843.1.76339 WP_000188843.1.76364 WP_000188843.1.76366 WP_000188843.1.76417 WP_000188843.1.76434 WP_000188843.1.76445 WP_000188843.1.7646 WP_000188843.1.76510 WP_000188843.1.76529 WP_000188843.1.76558 WP_000188843.1.76572 WP_000188843.1.7660 WP_000188843.1.76611 WP_000188843.1.76641 WP_000188843.1.76651 WP_000188843.1.76653 WP_000188843.1.76673 WP_000188843.1.76706 WP_000188843.1.7672 WP_000188843.1.76721 WP_000188843.1.76724 WP_000188843.1.76738 WP_000188843.1.76756 WP_000188843.1.76760 WP_000188843.1.76788 WP_000188843.1.76799 WP_000188843.1.76806 WP_000188843.1.7684 WP_000188843.1.76854 WP_000188843.1.76866 WP_000188843.1.76875 WP_000188843.1.76880 WP_000188843.1.76899 WP_000188843.1.76916 WP_000188843.1.76932 WP_000188843.1.76973 WP_000188843.1.76988 WP_000188843.1.77016 WP_000188843.1.77017 WP_000188843.1.77038 WP_000188843.1.77047 WP_000188843.1.77080 WP_000188843.1.77087 WP_000188843.1.77090 WP_000188843.1.77111 WP_000188843.1.7712 WP_000188843.1.77177 WP_000188843.1.77180 WP_000188843.1.77193 WP_000188843.1.77241 WP_000188843.1.77244 WP_000188843.1.77267 WP_000188843.1.77292 WP_000188843.1.77299 WP_000188843.1.77349 WP_000188843.1.77384 WP_000188843.1.77414 WP_000188843.1.77501 WP_000188843.1.77512 WP_000188843.1.77513 WP_000188843.1.77514 WP_000188843.1.77529 WP_000188843.1.77543 WP_000188843.1.77549 WP_000188843.1.77563 WP_000188843.1.77596 WP_000188843.1.77692 WP_000188843.1.77702 WP_000188843.1.77710 WP_000188843.1.77713 WP_000188843.1.7772 WP_000188843.1.77729 WP_000188843.1.7782 WP_000188843.1.77825 WP_000188843.1.77837 WP_000188843.1.77846 WP_000188843.1.77851 WP_000188843.1.77871 WP_000188843.1.77898 WP_000188843.1.77900 WP_000188843.1.77918 WP_000188843.1.77923 WP_000188843.1.77960 WP_000188843.1.77971 WP_000188843.1.77975 WP_000188843.1.78 WP_000188843.1.78033 WP_000188843.1.78035 WP_000188843.1.78048 WP_000188843.1.78076 WP_000188843.1.78096 WP_000188843.1.78100 WP_000188843.1.78107 WP_000188843.1.78110 WP_000188843.1.78120 WP_000188843.1.7814 WP_000188843.1.78166 WP_000188843.1.78180 WP_000188843.1.78192 WP_000188843.1.78195 WP_000188843.1.78201 WP_000188843.1.78291 WP_000188843.1.78309 WP_000188843.1.78320 WP_000188843.1.78366 WP_000188843.1.78372 WP_000188843.1.78382 WP_000188843.1.78383 WP_000188843.1.78388 WP_000188843.1.78407 WP_000188843.1.78410 WP_000188843.1.78502 WP_000188843.1.78602 WP_000188843.1.7861 WP_000188843.1.78618 WP_000188843.1.7862 WP_000188843.1.78626 WP_000188843.1.78661 WP_000188843.1.78673 WP_000188843.1.78674 WP_000188843.1.78676 WP_000188843.1.78735 WP_000188843.1.78761 WP_000188843.1.78771 WP_000188843.1.78789 WP_000188843.1.78802 WP_000188843.1.78830 WP_000188843.1.78835 WP_000188843.1.78838 WP_000188843.1.78862 WP_000188843.1.78871 WP_000188843.1.78874 WP_000188843.1.78881 WP_000188843.1.789 WP_000188843.1.7891 WP_000188843.1.78918 WP_000188843.1.78928 WP_000188843.1.78930 WP_000188843.1.78993 WP_000188843.1.79011 WP_000188843.1.79012 WP_000188843.1.79069 WP_000188843.1.79074 WP_000188843.1.79098 WP_000188843.1.79151 WP_000188843.1.79155 WP_000188843.1.79164 WP_000188843.1.79167 WP_000188843.1.79204 WP_000188843.1.79235 WP_000188843.1.79280 WP_000188843.1.79297 WP_000188843.1.79335 WP_000188843.1.79397 WP_000188843.1.794 WP_000188843.1.79456 WP_000188843.1.79462 WP_000188843.1.79466 WP_000188843.1.79472 WP_000188843.1.79490 WP_000188843.1.79495 WP_000188843.1.79529 WP_000188843.1.79532 WP_000188843.1.79547 WP_000188843.1.7956 WP_000188843.1.79570 WP_000188843.1.7964 WP_000188843.1.79642 WP_000188843.1.79654 WP_000188843.1.79659 WP_000188843.1.79668 WP_000188843.1.7970 WP_000188843.1.79708 WP_000188843.1.79722 WP_000188843.1.79734 WP_000188843.1.79738 WP_000188843.1.79772 WP_000188843.1.7979 WP_000188843.1.79832 WP_000188843.1.79845 WP_000188843.1.79880 WP_000188843.1.79916 WP_000188843.1.79929 WP_000188843.1.79934 WP_000188843.1.7994 WP_000188843.1.79974 WP_000188843.1.79996 WP_000188843.1.80065 WP_000188843.1.80077 WP_000188843.1.80103 WP_000188843.1.80137 WP_000188843.1.80182 WP_000188843.1.80229 WP_000188843.1.8024 WP_000188843.1.80273 WP_000188843.1.80282 WP_000188843.1.80293 WP_000188843.1.80296 WP_000188843.1.80307 WP_000188843.1.80354 WP_000188843.1.80366 WP_000188843.1.80368 WP_000188843.1.80386 WP_000188843.1.80400 WP_000188843.1.80448 WP_000188843.1.80462 WP_000188843.1.80473 WP_000188843.1.80480 WP_000188843.1.8049 WP_000188843.1.80492 WP_000188843.1.80496 WP_000188843.1.80529 WP_000188843.1.80569 WP_000188843.1.80586 WP_000188843.1.80664 WP_000188843.1.80696 WP_000188843.1.80707 WP_000188843.1.80723 WP_000188843.1.80725 WP_000188843.1.80741 WP_000188843.1.80757 WP_000188843.1.80831 WP_000188843.1.80850 WP_000188843.1.80881 WP_000188843.1.80913 WP_000188843.1.80939 WP_000188843.1.80959 WP_000188843.1.8096 WP_000188843.1.80984 WP_000188843.1.81037 WP_000188843.1.81069 WP_000188843.1.81118 WP_000188843.1.81131 WP_000188843.1.81149 WP_000188843.1.81175 WP_000188843.1.81187 WP_000188843.1.8119 WP_000188843.1.81193 WP_000188843.1.81262 WP_000188843.1.81268 WP_000188843.1.81269 WP_000188843.1.8127 WP_000188843.1.81271 WP_000188843.1.81305 WP_000188843.1.8131 WP_000188843.1.81320 WP_000188843.1.81328 WP_000188843.1.81333 WP_000188843.1.81342 WP_000188843.1.81354 WP_000188843.1.81364 WP_000188843.1.81404 WP_000188843.1.81410 WP_000188843.1.81425 WP_000188843.1.81472 WP_000188843.1.81494 WP_000188843.1.81528 WP_000188843.1.81557 WP_000188843.1.81667 WP_000188843.1.81676 WP_000188843.1.81681 WP_000188843.1.8170 WP_000188843.1.81735 WP_000188843.1.81736 WP_000188843.1.81750 WP_000188843.1.81760 WP_000188843.1.81763 WP_000188843.1.81785 WP_000188843.1.81855 WP_000188843.1.81902 WP_000188843.1.81921 WP_000188843.1.81931 WP_000188843.1.81936 WP_000188843.1.81941 WP_000188843.1.81949 WP_000188843.1.81974 WP_000188843.1.82070 WP_000188843.1.82076 WP_000188843.1.82099 WP_000188843.1.82131 WP_000188843.1.82156 WP_000188843.1.8218 WP_000188843.1.82180 WP_000188843.1.82192 WP_000188843.1.82201 WP_000188843.1.82214 WP_000188843.1.82225 WP_000188843.1.82232 WP_000188843.1.82337 WP_000188843.1.8240 WP_000188843.1.82408 WP_000188843.1.82416 WP_000188843.1.8242 WP_000188843.1.82456 WP_000188843.1.82464 WP_000188843.1.82465 WP_000188843.1.82473 WP_000188843.1.82479 WP_000188843.1.82503 WP_000188843.1.82515 WP_000188843.1.82529 WP_000188843.1.82553 WP_000188843.1.82584 WP_000188843.1.82646 WP_000188843.1.82670 WP_000188843.1.82676 WP_000188843.1.82731 WP_000188843.1.82761 WP_000188843.1.82763 WP_000188843.1.82812 WP_000188843.1.8282 WP_000188843.1.82841 WP_000188843.1.82850 WP_000188843.1.82867 WP_000188843.1.82872 WP_000188843.1.82895 WP_000188843.1.82908 WP_000188843.1.82937 WP_000188843.1.8294 WP_000188843.1.82944 WP_000188843.1.82956 WP_000188843.1.82959 WP_000188843.1.82964 WP_000188843.1.82992 WP_000188843.1.83007 WP_000188843.1.8304 WP_000188843.1.83061 WP_000188843.1.83092 WP_000188843.1.83163 WP_000188843.1.83180 WP_000188843.1.83229 WP_000188843.1.83235 WP_000188843.1.83258 WP_000188843.1.83290 WP_000188843.1.83305 WP_000188843.1.83333 WP_000188843.1.83365 WP_000188843.1.83413 WP_000188843.1.83491 WP_000188843.1.83523 WP_000188843.1.8354 WP_000188843.1.83650 WP_000188843.1.83651 WP_000188843.1.83657 WP_000188843.1.83677 WP_000188843.1.83721 WP_000188843.1.83739 WP_000188843.1.8375 WP_000188843.1.83759 WP_000188843.1.83760 WP_000188843.1.83854 WP_000188843.1.83923 WP_000188843.1.83979 WP_000188843.1.83994 WP_000188843.1.83995 WP_000188843.1.84 WP_000188843.1.8406 WP_000188843.1.84076 WP_000188843.1.84077 WP_000188843.1.84103 WP_000188843.1.84110 WP_000188843.1.84115 WP_000188843.1.84127 WP_000188843.1.84150 WP_000188843.1.84205 WP_000188843.1.84209 WP_000188843.1.84230 WP_000188843.1.84252 WP_000188843.1.84283 WP_000188843.1.84291 WP_000188843.1.8431 WP_000188843.1.84345 WP_000188843.1.84355 WP_000188843.1.84359 WP_000188843.1.84369 WP_000188843.1.84373 WP_000188843.1.84392 WP_000188843.1.84397 WP_000188843.1.84401 WP_000188843.1.84403 WP_000188843.1.8441 WP_000188843.1.84435 WP_000188843.1.84459 WP_000188843.1.84532 WP_000188843.1.84554 WP_000188843.1.84567 WP_000188843.1.84631 WP_000188843.1.84644 WP_000188843.1.84659 WP_000188843.1.84693 WP_000188843.1.84727 WP_000188843.1.84744 WP_000188843.1.84745 WP_000188843.1.84773 WP_000188843.1.84899 WP_000188843.1.84945 WP_000188843.1.84967 WP_000188843.1.8497 WP_000188843.1.85004 WP_000188843.1.8502 WP_000188843.1.85039 WP_000188843.1.85040 WP_000188843.1.85120 WP_000188843.1.85134 WP_000188843.1.85153 WP_000188843.1.85178 WP_000188843.1.85180 WP_000188843.1.85190 WP_000188843.1.85217 WP_000188843.1.85273 WP_000188843.1.8533 WP_000188843.1.85338 WP_000188843.1.85339 WP_000188843.1.8537 WP_000188843.1.85408 WP_000188843.1.8545 WP_000188843.1.85456 WP_000188843.1.85469 WP_000188843.1.85481 WP_000188843.1.85483 WP_000188843.1.85511 WP_000188843.1.85512 WP_000188843.1.8552 WP_000188843.1.85541 WP_000188843.1.8556 WP_000188843.1.85568 WP_000188843.1.8557 WP_000188843.1.85606 WP_000188843.1.85615 WP_000188843.1.85617 WP_000188843.1.85635 WP_000188843.1.85646 WP_000188843.1.85663 WP_000188843.1.85665 WP_000188843.1.85669 WP_000188843.1.85671 WP_000188843.1.85672 WP_000188843.1.85688 WP_000188843.1.85703 WP_000188843.1.85728 WP_000188843.1.85746 WP_000188843.1.85777 WP_000188843.1.85780 WP_000188843.1.85811 WP_000188843.1.85855 WP_000188843.1.85886 WP_000188843.1.859 WP_000188843.1.85900 WP_000188843.1.85904 WP_000188843.1.85917 WP_000188843.1.8594 WP_000188843.1.85976 WP_000188843.1.85977 WP_000188843.1.860 WP_000188843.1.86043 WP_000188843.1.8605 WP_000188843.1.86084 WP_000188843.1.86092 WP_000188843.1.8610 WP_000188843.1.8614 WP_000188843.1.86156 WP_000188843.1.86173 WP_000188843.1.86206 WP_000188843.1.86224 WP_000188843.1.86259 WP_000188843.1.86284 WP_000188843.1.86285 WP_000188843.1.86306 WP_000188843.1.86310 WP_000188843.1.86323 WP_000188843.1.86342 WP_000188843.1.86356 WP_000188843.1.8640 WP_000188843.1.8642 WP_000188843.1.86426 WP_000188843.1.86442 WP_000188843.1.86450 WP_000188843.1.86453 WP_000188843.1.86469 WP_000188843.1.86489 WP_000188843.1.86530 WP_000188843.1.86580 WP_000188843.1.86588 WP_000188843.1.86593 WP_000188843.1.86656 WP_000188843.1.86658 WP_000188843.1.86661 WP_000188843.1.86663 WP_000188843.1.86676 WP_000188843.1.8671 WP_000188843.1.8672 WP_000188843.1.86770 WP_000188843.1.8678 WP_000188843.1.86794 WP_000188843.1.86800 WP_000188843.1.86810 WP_000188843.1.86811 WP_000188843.1.86815 WP_000188843.1.8684 WP_000188843.1.86859 WP_000188843.1.86895 WP_000188843.1.86906 WP_000188843.1.8691 WP_000188843.1.86945 WP_000188843.1.86982 WP_000188843.1.86989 WP_000188843.1.87023 WP_000188843.1.87034 WP_000188843.1.87041 WP_000188843.1.87051 WP_000188843.1.87095 WP_000188843.1.87136 WP_000188843.1.87143 WP_000188843.1.87155 WP_000188843.1.87258 WP_000188843.1.87282 WP_000188843.1.87283 WP_000188843.1.87293 WP_000188843.1.87323 WP_000188843.1.8736 WP_000188843.1.87365 WP_000188843.1.87420 WP_000188843.1.87460 WP_000188843.1.87493 WP_000188843.1.87528 WP_000188843.1.87552 WP_000188843.1.87560 WP_000188843.1.8760 WP_000188843.1.87600 WP_000188843.1.87609 WP_000188843.1.87612 WP_000188843.1.87615 WP_000188843.1.87626 WP_000188843.1.87653 WP_000188843.1.87659 WP_000188843.1.87695 WP_000188843.1.87698 WP_000188843.1.87706 WP_000188843.1.87739 WP_000188843.1.87741 WP_000188843.1.87742 WP_000188843.1.87779 WP_000188843.1.87852 WP_000188843.1.87875 WP_000188843.1.87899 WP_000188843.1.8792 WP_000188843.1.87933 WP_000188843.1.87945 WP_000188843.1.87949 WP_000188843.1.88019 WP_000188843.1.88025 WP_000188843.1.88026 WP_000188843.1.8805 WP_000188843.1.8806 WP_000188843.1.88073 WP_000188843.1.8809 WP_000188843.1.88092 WP_000188843.1.881 WP_000188843.1.88145 WP_000188843.1.88165 WP_000188843.1.88199 WP_000188843.1.88214 WP_000188843.1.88291 WP_000188843.1.88293 WP_000188843.1.88299 WP_000188843.1.88303 WP_000188843.1.88313 WP_000188843.1.88359 WP_000188843.1.8837 WP_000188843.1.88393 WP_000188843.1.88407 WP_000188843.1.88414 WP_000188843.1.88444 WP_000188843.1.88446 WP_000188843.1.88458 WP_000188843.1.8849 WP_000188843.1.88501 WP_000188843.1.88538 WP_000188843.1.88547 WP_000188843.1.886 WP_000188843.1.88624 WP_000188843.1.88647 WP_000188843.1.88648 WP_000188843.1.88683 WP_000188843.1.88692 WP_000188843.1.88703 WP_000188843.1.88707 WP_000188843.1.88727 WP_000188843.1.88762 WP_000188843.1.88772 WP_000188843.1.88776 WP_000188843.1.88792 WP_000188843.1.88850 WP_000188843.1.8889 WP_000188843.1.88892 WP_000188843.1.88894 WP_000188843.1.88902 WP_000188843.1.8891 WP_000188843.1.88957 WP_000188843.1.88967 WP_000188843.1.88970 WP_000188843.1.88980 WP_000188843.1.88981 WP_000188843.1.89008 WP_000188843.1.89114 WP_000188843.1.89116 WP_000188843.1.89119 WP_000188843.1.89138 WP_000188843.1.89182 WP_000188843.1.89291 WP_000188843.1.89298 WP_000188843.1.89304 WP_000188843.1.89308 WP_000188843.1.89314 WP_000188843.1.89328 WP_000188843.1.89332 WP_000188843.1.89343 WP_000188843.1.89354 WP_000188843.1.89395 WP_000188843.1.8940 WP_000188843.1.89449 WP_000188843.1.8947 WP_000188843.1.89503 WP_000188843.1.89512 WP_000188843.1.89527 WP_000188843.1.89570 WP_000188843.1.8958 WP_000188843.1.89591 WP_000188843.1.89604 WP_000188843.1.89612 WP_000188843.1.89622 WP_000188843.1.89657 WP_000188843.1.89668 WP_000188843.1.89706 WP_000188843.1.89713 WP_000188843.1.89733 WP_000188843.1.89746 WP_000188843.1.89765 WP_000188843.1.89789 WP_000188843.1.89796 WP_000188843.1.89804 WP_000188843.1.89815 WP_000188843.1.89817 WP_000188843.1.89845 WP_000188843.1.89870 WP_000188843.1.89888 WP_000188843.1.89902 WP_000188843.1.89911 WP_000188843.1.8995 WP_000188843.1.89952 WP_000188843.1.8996 WP_000188843.1.90007 WP_000188843.1.9002 WP_000188843.1.90097 WP_000188843.1.9011 WP_000188843.1.90196 WP_000188843.1.90240 WP_000188843.1.90248 WP_000188843.1.90252 WP_000188843.1.90274 WP_000188843.1.90280 WP_000188843.1.90293 WP_000188843.1.90330 WP_000188843.1.90338 WP_000188843.1.90348 WP_000188843.1.90363 WP_000188843.1.90365 WP_000188843.1.90409 WP_000188843.1.90417 WP_000188843.1.90428 WP_000188843.1.90440 WP_000188843.1.90453 WP_000188843.1.90458 WP_000188843.1.90489 WP_000188843.1.90513 WP_000188843.1.90521 WP_000188843.1.90557 WP_000188843.1.90582 WP_000188843.1.90585 WP_000188843.1.9064 WP_000188843.1.90641 WP_000188843.1.90713 WP_000188843.1.90734 WP_000188843.1.90794 WP_000188843.1.90796 WP_000188843.1.90811 WP_000188843.1.90814 WP_000188843.1.90866 WP_000188843.1.90878 WP_000188843.1.9089 WP_000188843.1.9091 WP_000188843.1.9093 WP_000188843.1.90991 WP_000188843.1.91003 WP_000188843.1.91056 WP_000188843.1.91067 WP_000188843.1.91156 WP_000188843.1.91164 WP_000188843.1.91179 WP_000188843.1.91189 WP_000188843.1.91205 WP_000188843.1.91239 WP_000188843.1.91278 WP_000188843.1.91291 WP_000188843.1.9131 WP_000188843.1.91313 WP_000188843.1.91334 WP_000188843.1.9135 WP_000188843.1.91470 WP_000188843.1.91493 WP_000188843.1.91506 WP_000188843.1.91512 WP_000188843.1.91524 WP_000188843.1.91528 WP_000188843.1.91557 WP_000188843.1.91564 WP_000188843.1.91597 WP_000188843.1.91621 WP_000188843.1.91628 WP_000188843.1.91655 WP_000188843.1.91715 WP_000188843.1.91724 WP_000188843.1.91732 WP_000188843.1.91788 WP_000188843.1.91864 WP_000188843.1.9187 WP_000188843.1.91870 WP_000188843.1.91880 WP_000188843.1.91903 WP_000188843.1.92013 WP_000188843.1.92018 WP_000188843.1.92047 WP_000188843.1.92060 WP_000188843.1.92068 WP_000188843.1.92087 WP_000188843.1.92093 WP_000188843.1.92098 WP_000188843.1.92099 WP_000188843.1.92108 WP_000188843.1.92122 WP_000188843.1.92156 WP_000188843.1.92165 WP_000188843.1.92171 WP_000188843.1.92172 WP_000188843.1.92183 WP_000188843.1.92208 WP_000188843.1.92240 WP_000188843.1.92243 WP_000188843.1.92268 WP_000188843.1.92299 WP_000188843.1.92310 WP_000188843.1.92318 WP_000188843.1.92327 WP_000188843.1.92394 WP_000188843.1.92408 WP_000188843.1.92439 WP_000188843.1.92443 WP_000188843.1.92470 WP_000188843.1.92477 WP_000188843.1.92482 WP_000188843.1.92531 WP_000188843.1.92545 WP_000188843.1.92562 WP_000188843.1.92570 WP_000188843.1.92588 WP_000188843.1.926 WP_000188843.1.92633 WP_000188843.1.92649 WP_000188843.1.92659 WP_000188843.1.92671 WP_000188843.1.92676 WP_000188843.1.92705 WP_000188843.1.9271 WP_000188843.1.92729 WP_000188843.1.92734 WP_000188843.1.92738 WP_000188843.1.92810 WP_000188843.1.92823 WP_000188843.1.92827 WP_000188843.1.92832 WP_000188843.1.92836 WP_000188843.1.92843 WP_000188843.1.92883 WP_000188843.1.92893 WP_000188843.1.92939 WP_000188843.1.92975 WP_000188843.1.92987 WP_000188843.1.93007 WP_000188843.1.93022 WP_000188843.1.93059 WP_000188843.1.93086 WP_000188843.1.93101 WP_000188843.1.93103 WP_000188843.1.93105 WP_000188843.1.93111 WP_000188843.1.93121 WP_000188843.1.93136 WP_000188843.1.93155 WP_000188843.1.93168 WP_000188843.1.93184 WP_000188843.1.93221 WP_000188843.1.93223 WP_000188843.1.93239 WP_000188843.1.93275 WP_000188843.1.93302 WP_000188843.1.93339 WP_000188843.1.9336 WP_000188843.1.93365 WP_000188843.1.93376 WP_000188843.1.93387 WP_000188843.1.93469 WP_000188843.1.93511 WP_000188843.1.93512 WP_000188843.1.93543 WP_000188843.1.93596 WP_000188843.1.93635 WP_000188843.1.93648 WP_000188843.1.93650 WP_000188843.1.93656 WP_000188843.1.93657 WP_000188843.1.93662 WP_000188843.1.937 WP_000188843.1.93705 WP_000188843.1.9374 WP_000188843.1.93741 WP_000188843.1.9375 WP_000188843.1.93754 WP_000188843.1.93761 WP_000188843.1.93780 WP_000188843.1.93803 WP_000188843.1.93804 WP_000188843.1.93828 WP_000188843.1.93842 WP_000188843.1.93843 WP_000188843.1.93875 WP_000188843.1.9389 WP_000188843.1.93909 WP_000188843.1.93919 WP_000188843.1.93937 WP_000188843.1.93938 WP_000188843.1.93984 WP_000188843.1.9399 WP_000188843.1.93994 WP_000188843.1.94017 WP_000188843.1.94064 WP_000188843.1.94072 WP_000188843.1.94079 WP_000188843.1.94097 WP_000188843.1.94107 WP_000188843.1.94142 WP_000188843.1.94162 WP_000188843.1.94168 WP_000188843.1.94198 WP_000188843.1.94215 WP_000188843.1.94303 WP_000188843.1.9432 WP_000188843.1.94354 WP_000188843.1.94365 WP_000188843.1.94380 WP_000188843.1.94390 WP_000188843.1.94415 WP_000188843.1.94458 WP_000188843.1.94492 WP_000188843.1.94510 WP_000188843.1.94527 WP_000188843.1.94557 WP_000188843.1.94565 WP_000188843.1.94573 WP_000188843.1.94579 WP_000188843.1.94584 WP_000188843.1.94586 WP_000188843.1.94593 WP_000188843.1.94622 WP_000188843.1.9463 WP_000188843.1.94650 WP_000188843.1.94655 WP_000188843.1.94659 WP_000188843.1.94662 WP_000188843.1.94674 WP_000188843.1.94700 WP_000188843.1.94717 WP_000188843.1.94745 WP_000188843.1.94782 WP_000188843.1.94796 WP_000188843.1.9481 WP_000188843.1.94815 WP_000188843.1.94820 WP_000188843.1.94850 WP_000188843.1.94851 WP_000188843.1.94864 WP_000188843.1.94947 WP_000188843.1.94952 WP_000188843.1.94959 WP_000188843.1.94967 WP_000188843.1.94986 WP_000188843.1.95006 WP_000188843.1.95051 WP_000188843.1.95055 WP_000188843.1.95076 WP_000188843.1.95085 WP_000188843.1.95099 WP_000188843.1.95121 WP_000188843.1.9516 WP_000188843.1.95165 WP_000188843.1.95171 WP_000188843.1.95235 WP_000188843.1.95239 WP_000188843.1.95246 WP_000188843.1.95248 WP_000188843.1.95249 WP_000188843.1.9525 WP_000188843.1.95255 WP_000188843.1.95265 WP_000188843.1.95277 WP_000188843.1.95282 WP_000188843.1.95338 WP_000188843.1.95388 WP_000188843.1.95412 WP_000188843.1.95530 WP_000188843.1.95546 WP_000188843.1.95547 WP_000188843.1.95590 WP_000188843.1.95623 WP_000188843.1.95625 WP_000188843.1.95630 WP_000188843.1.95670 WP_000188843.1.95675 WP_000188843.1.95691 WP_000188843.1.95703 WP_000188843.1.95716 WP_000188843.1.95729 WP_000188843.1.9574 WP_000188843.1.95776 WP_000188843.1.95840 WP_000188843.1.95884 WP_000188843.1.95890 WP_000188843.1.95901 WP_000188843.1.95906 WP_000188843.1.95911 WP_000188843.1.95939 WP_000188843.1.96004 WP_000188843.1.96025 WP_000188843.1.96042 WP_000188843.1.96044 WP_000188843.1.96054 WP_000188843.1.9609 WP_000188843.1.96094 WP_000188843.1.96127 WP_000188843.1.96139 WP_000188843.1.96144 WP_000188843.1.96162 WP_000188843.1.96172 WP_000188843.1.96188 WP_000188843.1.96206 WP_000188843.1.96211 WP_000188843.1.96212 WP_000188843.1.96260 WP_000188843.1.9627 WP_000188843.1.96317 WP_000188843.1.96319 WP_000188843.1.9633 WP_000188843.1.96335 WP_000188843.1.96343 WP_000188843.1.96359 WP_000188843.1.96404 WP_000188843.1.9644 WP_000188843.1.96469 WP_000188843.1.96497 WP_000188843.1.96500 WP_000188843.1.96539 WP_000188843.1.96552 WP_000188843.1.96555 WP_000188843.1.96563 WP_000188843.1.96610 WP_000188843.1.96625 WP_000188843.1.96635 WP_000188843.1.9664 WP_000188843.1.96642 WP_000188843.1.96675 WP_000188843.1.9670 WP_000188843.1.96721 WP_000188843.1.96732 WP_000188843.1.9674 WP_000188843.1.96750 WP_000188843.1.96771 WP_000188843.1.96792 WP_000188843.1.96798 WP_000188843.1.96801 WP_000188843.1.96803 WP_000188843.1.96810 WP_000188843.1.96902 WP_000188843.1.96925 WP_000188843.1.96938 WP_000188843.1.96946 WP_000188843.1.96957 WP_000188843.1.96978 WP_000188843.1.97005 WP_000188843.1.97015 WP_000188843.1.97026 WP_000188843.1.97028 WP_000188843.1.97047 WP_000188843.1.97079 WP_000188843.1.97143 WP_000188843.1.97145 WP_000188843.1.97154 WP_000188843.1.97184 WP_000188843.1.97190 WP_000188843.1.97287 WP_000188843.1.97291 WP_000188843.1.97297 WP_000188843.1.97318 WP_000188843.1.97368 WP_000188843.1.97369 WP_000188843.1.97422 WP_000188843.1.97441 WP_000188843.1.97477 WP_000188843.1.97487 WP_000188843.1.97496 WP_000188843.1.97497 WP_000188843.1.97505 WP_000188843.1.97594 WP_000188843.1.97597 WP_000188843.1.97599 WP_000188843.1.97606 WP_000188843.1.97613 WP_000188843.1.97615 WP_000188843.1.97620 WP_000188843.1.97631 WP_000188843.1.97640 WP_000188843.1.97646 WP_000188843.1.97690 WP_000188843.1.97725 WP_000188843.1.97726 WP_000188843.1.97727 WP_000188843.1.97732 WP_000188843.1.97736 WP_000188843.1.9775 WP_000188843.1.97819 WP_000188843.1.97840 WP_000188843.1.97846 WP_000188843.1.97938 WP_000188843.1.97986 WP_000188843.1.9799 WP_000188843.1.98006 WP_000188843.1.98019 WP_000188843.1.98022 WP_000188843.1.98036 WP_000188843.1.98080 WP_000188843.1.98086 WP_000188843.1.98110 WP_000188843.1.98124 WP_000188843.1.98146 WP_000188843.1.98158 WP_000188843.1.98170 WP_000188843.1.98201 WP_000188843.1.98219 WP_000188843.1.9826 WP_000188843.1.98263 WP_000188843.1.98314 WP_000188843.1.9841 WP_000188843.1.98418 WP_000188843.1.98446 WP_000188843.1.98448 WP_000188843.1.98457 WP_000188843.1.98495 WP_000188843.1.9850 WP_000188843.1.98502 WP_000188843.1.98513 WP_000188843.1.98531 WP_000188843.1.98577 WP_000188843.1.98607 WP_000188843.1.98608 WP_000188843.1.9863 WP_000188843.1.98676 WP_000188843.1.98677 WP_000188843.1.98731 WP_000188843.1.98760 WP_000188843.1.98762 WP_000188843.1.9877 WP_000188843.1.98801 WP_000188843.1.98818 WP_000188843.1.98843 WP_000188843.1.98899 WP_000188843.1.9898 WP_000188843.1.99071 WP_000188843.1.99072 WP_000188843.1.99083 WP_000188843.1.99098 WP_000188843.1.99163 WP_000188843.1.99184 WP_000188843.1.99267 WP_000188843.1.99276 WP_000188843.1.99278 WP_000188843.1.99335 WP_000188843.1.99350 WP_000188843.1.99360 WP_000188843.1.99363 WP_000188843.1.99369 WP_000188843.1.99388 WP_000188843.1.99397 WP_000188843.1.99463 WP_000188843.1.99483 WP_000188843.1.99546 WP_000188843.1.99561 WP_000188843.1.99579 WP_000188843.1.99595 WP_000188843.1.99626 WP_000188843.1.99646 WP_000188843.1.99657 WP_000188843.1.99660 WP_000188843.1.99671 WP_000188843.1.99676 WP_000188843.1.99712 WP_000188843.1.99725 WP_000188843.1.99747 WP_000188843.1.99764 WP_000188843.1.99813 WP_000188843.1.99829 WP_000188843.1.99837 WP_000188843.1.99841 WP_000188843.1.99858 WP_000188843.1.99889 WP_000188843.1.9992 WP_000188843.1.99958 WP_000188843.1.99996 gi|383497963|ref|YP_005398652.1| gi|550902664|ref|YP_008671756.1| gi|29143560|ref|NP_806902.1| gi|525859031|ref|YP_008262564.1| gi|197249208|ref|YP_002148234.1| ABAM02000001|CDS_3850296-3850000 ABAN01000014|CDS_19152-19448 ABAO01000041|CDS_5607-5311 ABEJ01000014|CDS_95003-94707 ABEL01000006|CDS_196916-196620 ABFG01000007|CDS_95044-95340 ABFH02000001|CDS_1693264-1693560 AE006468|CDS_3476946-3476650 AE014613|CDS_3316967-3316671 AL513382|CDS_3331472-3331176 CP000886|CDS_3436617-3436321 CP001113|CDS_3459005-3458709 CP001120|CDS_3492261-3491965 CP001127|CDS_3376078-3375782 CP001138|CDS_3394157-3393861 CP001363|CDS_3490842-3490546 FN424405|CDS_3500082-3499786 gi|482905878|ref|YP_007904438.1| gi|194738002|ref|YP_002116259.1| gi|488655683|ref|YP_007927486.1| gi|378452129|ref|YP_005239489.1| gi|386592994|ref|YP_006089394.1| gi|378701209|ref|YP_005183167.1| gi|378985907|ref|YP_005249063.1| gi|525828916|ref|YP_008251895.1| gi|549725869|ref|YP_008646059.1| gi|194450078|ref|YP_002047338.1| gi|16766604|ref|NP_462219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]