SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC26000 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC26000
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.48e-29
Family MarR-like transcriptional regulators 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC26000
Sequence length 147
Comment $ MCSG $ SQ19806 $ PDBT65349 $
Sequence
MSVINDESLSLKLFVILSRAVQSITKRIEEDIKSYGLNPTEFAVLELLYSKGDQPIQKIG
DKILLASSSITYVVDKLEKKRFLIRKPCPKDRRVTYASITSEGIELMDIIFPQHKEAIRQ
ILGGLDYIDKKMIIHKLKKLGYYALEL
Download sequence
Identical sequences Q81BM5
226900.BC3128 NP_832869.1.86172 gi|30021238|ref|NP_832869.1| APC26000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]