SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC26804 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC26804
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-17
Family Anti-sigma factor antagonist SpoIIaa 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC26804
Sequence length 109
Comment $ MCSG $ SQ20605 $ PDBT66250 $
Sequence
MSHPQWSAENEHQFSLIGELDRETVPKLWIFLKNWQPQVKQIELSLQQVVRIDSAGMVLL
IHLIEHAKVRNCHIMLSFVPEQLRTLFQLSNIEHLMSQHIAKPAEVNCG
Download sequence
Identical sequences A0A0H3AP10 A0A0H3QB98 A0A0H6H523 A0A0K9UQJ1 A0A0X1L3K2 A0A2J9UBX1 C2HWZ9 C3LRI0 D7HFF4 Q9KP60
243277.VC2516 345073.VC0395_A2098 579112.VCM66_2438 593588.VCD_001842 gi|147675756|ref|YP_001218014.1| NP_232145.1.72393 WP_000019311.1.100264 WP_000019311.1.100388 WP_000019311.1.100440 WP_000019311.1.10071 WP_000019311.1.100976 WP_000019311.1.101051 WP_000019311.1.101117 WP_000019311.1.10121 WP_000019311.1.101220 WP_000019311.1.101314 WP_000019311.1.101507 WP_000019311.1.101933 WP_000019311.1.102054 WP_000019311.1.1024 WP_000019311.1.10626 WP_000019311.1.10834 WP_000019311.1.10874 WP_000019311.1.10887 WP_000019311.1.11270 WP_000019311.1.11879 WP_000019311.1.11885 WP_000019311.1.11965 WP_000019311.1.12252 WP_000019311.1.12262 WP_000019311.1.12332 WP_000019311.1.12525 WP_000019311.1.12527 WP_000019311.1.12548 WP_000019311.1.12590 WP_000019311.1.12686 WP_000019311.1.12828 WP_000019311.1.12902 WP_000019311.1.13053 WP_000019311.1.13155 WP_000019311.1.13156 WP_000019311.1.13395 WP_000019311.1.13454 WP_000019311.1.13652 WP_000019311.1.13725 WP_000019311.1.14080 WP_000019311.1.14179 WP_000019311.1.14257 WP_000019311.1.14263 WP_000019311.1.14353 WP_000019311.1.14553 WP_000019311.1.14904 WP_000019311.1.14995 WP_000019311.1.15109 WP_000019311.1.15134 WP_000019311.1.15179 WP_000019311.1.15200 WP_000019311.1.15516 WP_000019311.1.15786 WP_000019311.1.15919 WP_000019311.1.15997 WP_000019311.1.16115 WP_000019311.1.16351 WP_000019311.1.16382 WP_000019311.1.17001 WP_000019311.1.17232 WP_000019311.1.17295 WP_000019311.1.17621 WP_000019311.1.17738 WP_000019311.1.18375 WP_000019311.1.18392 WP_000019311.1.18447 WP_000019311.1.18484 WP_000019311.1.18577 WP_000019311.1.18845 WP_000019311.1.18862 WP_000019311.1.18916 WP_000019311.1.19126 WP_000019311.1.19128 WP_000019311.1.19428 WP_000019311.1.19442 WP_000019311.1.19503 WP_000019311.1.19597 WP_000019311.1.20065 WP_000019311.1.20107 WP_000019311.1.20336 WP_000019311.1.20379 WP_000019311.1.20404 WP_000019311.1.20602 WP_000019311.1.20669 WP_000019311.1.20699 WP_000019311.1.20758 WP_000019311.1.21073 WP_000019311.1.21179 WP_000019311.1.21279 WP_000019311.1.21281 WP_000019311.1.21558 WP_000019311.1.21671 WP_000019311.1.21717 WP_000019311.1.21764 WP_000019311.1.21815 WP_000019311.1.21866 WP_000019311.1.22521 WP_000019311.1.22773 WP_000019311.1.229 WP_000019311.1.22953 WP_000019311.1.2304 WP_000019311.1.23134 WP_000019311.1.2316 WP_000019311.1.23333 WP_000019311.1.2341 WP_000019311.1.23416 WP_000019311.1.23424 WP_000019311.1.23532 WP_000019311.1.23538 WP_000019311.1.2354 WP_000019311.1.23808 WP_000019311.1.23955 WP_000019311.1.240 WP_000019311.1.2401 WP_000019311.1.24106 WP_000019311.1.24280 WP_000019311.1.24345 WP_000019311.1.24399 WP_000019311.1.2496 WP_000019311.1.24980 WP_000019311.1.25386 WP_000019311.1.25649 WP_000019311.1.26020 WP_000019311.1.26156 WP_000019311.1.26223 WP_000019311.1.2627 WP_000019311.1.26326 WP_000019311.1.26508 WP_000019311.1.26580 WP_000019311.1.26813 WP_000019311.1.27186 WP_000019311.1.27435 WP_000019311.1.27458 WP_000019311.1.27639 WP_000019311.1.27822 WP_000019311.1.27863 WP_000019311.1.28431 WP_000019311.1.2849 WP_000019311.1.28508 WP_000019311.1.29095 WP_000019311.1.29535 WP_000019311.1.29708 WP_000019311.1.29889 WP_000019311.1.30107 WP_000019311.1.30292 WP_000019311.1.3032 WP_000019311.1.30360 WP_000019311.1.3054 WP_000019311.1.30927 WP_000019311.1.31096 WP_000019311.1.31718 WP_000019311.1.31853 WP_000019311.1.32111 WP_000019311.1.32264 WP_000019311.1.32271 WP_000019311.1.32814 WP_000019311.1.32955 WP_000019311.1.33093 WP_000019311.1.33625 WP_000019311.1.33811 WP_000019311.1.33819 WP_000019311.1.34108 WP_000019311.1.34133 WP_000019311.1.34195 WP_000019311.1.34261 WP_000019311.1.34634 WP_000019311.1.34643 WP_000019311.1.34663 WP_000019311.1.3514 WP_000019311.1.35201 WP_000019311.1.35266 WP_000019311.1.35630 WP_000019311.1.35880 WP_000019311.1.35881 WP_000019311.1.36322 WP_000019311.1.3635 WP_000019311.1.36354 WP_000019311.1.36364 WP_000019311.1.36441 WP_000019311.1.36513 WP_000019311.1.36668 WP_000019311.1.36686 WP_000019311.1.36973 WP_000019311.1.37054 WP_000019311.1.37260 WP_000019311.1.37262 WP_000019311.1.37537 WP_000019311.1.37676 WP_000019311.1.37784 WP_000019311.1.37999 WP_000019311.1.38420 WP_000019311.1.38590 WP_000019311.1.39208 WP_000019311.1.39514 WP_000019311.1.39675 WP_000019311.1.39853 WP_000019311.1.39933 WP_000019311.1.40039 WP_000019311.1.40152 WP_000019311.1.40433 WP_000019311.1.40459 WP_000019311.1.40470 WP_000019311.1.40484 WP_000019311.1.40491 WP_000019311.1.40542 WP_000019311.1.40571 WP_000019311.1.40740 WP_000019311.1.40782 WP_000019311.1.41284 WP_000019311.1.41538 WP_000019311.1.41569 WP_000019311.1.41573 WP_000019311.1.4175 WP_000019311.1.41883 WP_000019311.1.42128 WP_000019311.1.42152 WP_000019311.1.42498 WP_000019311.1.42617 WP_000019311.1.4272 WP_000019311.1.42783 WP_000019311.1.4284 WP_000019311.1.42853 WP_000019311.1.42865 WP_000019311.1.42885 WP_000019311.1.43103 WP_000019311.1.43222 WP_000019311.1.43335 WP_000019311.1.4365 WP_000019311.1.43884 WP_000019311.1.439 WP_000019311.1.44555 WP_000019311.1.44569 WP_000019311.1.44709 WP_000019311.1.44730 WP_000019311.1.45055 WP_000019311.1.45127 WP_000019311.1.45155 WP_000019311.1.45206 WP_000019311.1.45264 WP_000019311.1.45372 WP_000019311.1.45704 WP_000019311.1.45842 WP_000019311.1.45903 WP_000019311.1.45958 WP_000019311.1.46118 WP_000019311.1.46146 WP_000019311.1.46486 WP_000019311.1.46540 WP_000019311.1.4661 WP_000019311.1.4701 WP_000019311.1.47202 WP_000019311.1.4730 WP_000019311.1.4731 WP_000019311.1.47417 WP_000019311.1.47428 WP_000019311.1.47736 WP_000019311.1.47794 WP_000019311.1.47796 WP_000019311.1.47846 WP_000019311.1.47942 WP_000019311.1.48128 WP_000019311.1.48289 WP_000019311.1.48305 WP_000019311.1.48715 WP_000019311.1.48742 WP_000019311.1.488 WP_000019311.1.48927 WP_000019311.1.48984 WP_000019311.1.49238 WP_000019311.1.49317 WP_000019311.1.49593 WP_000019311.1.50254 WP_000019311.1.50277 WP_000019311.1.5028 WP_000019311.1.50577 WP_000019311.1.50625 WP_000019311.1.50813 WP_000019311.1.50822 WP_000019311.1.50899 WP_000019311.1.50980 WP_000019311.1.51160 WP_000019311.1.51163 WP_000019311.1.51177 WP_000019311.1.51661 WP_000019311.1.5201 WP_000019311.1.52391 WP_000019311.1.52676 WP_000019311.1.53085 WP_000019311.1.5320 WP_000019311.1.53214 WP_000019311.1.53823 WP_000019311.1.5397 WP_000019311.1.54191 WP_000019311.1.5425 WP_000019311.1.54398 WP_000019311.1.5450 WP_000019311.1.54706 WP_000019311.1.54901 WP_000019311.1.55092 WP_000019311.1.55208 WP_000019311.1.55665 WP_000019311.1.55917 WP_000019311.1.55929 WP_000019311.1.55932 WP_000019311.1.56429 WP_000019311.1.56785 WP_000019311.1.56807 WP_000019311.1.57098 WP_000019311.1.57148 WP_000019311.1.57300 WP_000019311.1.57518 WP_000019311.1.57546 WP_000019311.1.57678 WP_000019311.1.57751 WP_000019311.1.57945 WP_000019311.1.58295 WP_000019311.1.58367 WP_000019311.1.58596 WP_000019311.1.58844 WP_000019311.1.58975 WP_000019311.1.59010 WP_000019311.1.59194 WP_000019311.1.59378 WP_000019311.1.59394 WP_000019311.1.5943 WP_000019311.1.59554 WP_000019311.1.59633 WP_000019311.1.59741 WP_000019311.1.59916 WP_000019311.1.60216 WP_000019311.1.60386 WP_000019311.1.60633 WP_000019311.1.60694 WP_000019311.1.60800 WP_000019311.1.60955 WP_000019311.1.61169 WP_000019311.1.61523 WP_000019311.1.61624 WP_000019311.1.61644 WP_000019311.1.61753 WP_000019311.1.61869 WP_000019311.1.61875 WP_000019311.1.61935 WP_000019311.1.62165 WP_000019311.1.62324 WP_000019311.1.62425 WP_000019311.1.63347 WP_000019311.1.63546 WP_000019311.1.63655 WP_000019311.1.6366 WP_000019311.1.63723 WP_000019311.1.63749 WP_000019311.1.63779 WP_000019311.1.63911 WP_000019311.1.64201 WP_000019311.1.64253 WP_000019311.1.64315 WP_000019311.1.64382 WP_000019311.1.64441 WP_000019311.1.6455 WP_000019311.1.65007 WP_000019311.1.65051 WP_000019311.1.65086 WP_000019311.1.65528 WP_000019311.1.66329 WP_000019311.1.66633 WP_000019311.1.66696 WP_000019311.1.67616 WP_000019311.1.67770 WP_000019311.1.68424 WP_000019311.1.68506 WP_000019311.1.68723 WP_000019311.1.68863 WP_000019311.1.68925 WP_000019311.1.69049 WP_000019311.1.69085 WP_000019311.1.69157 WP_000019311.1.69843 WP_000019311.1.69857 WP_000019311.1.69943 WP_000019311.1.70069 WP_000019311.1.70176 WP_000019311.1.70247 WP_000019311.1.7049 WP_000019311.1.70775 WP_000019311.1.70813 WP_000019311.1.70892 WP_000019311.1.71129 WP_000019311.1.72106 WP_000019311.1.72241 WP_000019311.1.72326 WP_000019311.1.72361 WP_000019311.1.72369 WP_000019311.1.7238 WP_000019311.1.72480 WP_000019311.1.72856 WP_000019311.1.72964 WP_000019311.1.73148 WP_000019311.1.73429 WP_000019311.1.73555 WP_000019311.1.73855 WP_000019311.1.73929 WP_000019311.1.74111 WP_000019311.1.74503 WP_000019311.1.74666 WP_000019311.1.74991 WP_000019311.1.75012 WP_000019311.1.75326 WP_000019311.1.75378 WP_000019311.1.755 WP_000019311.1.75778 WP_000019311.1.75796 WP_000019311.1.76271 WP_000019311.1.76320 WP_000019311.1.76425 WP_000019311.1.76486 WP_000019311.1.7654 WP_000019311.1.76645 WP_000019311.1.77029 WP_000019311.1.7717 WP_000019311.1.77355 WP_000019311.1.77397 WP_000019311.1.77445 WP_000019311.1.77703 WP_000019311.1.77794 WP_000019311.1.77830 WP_000019311.1.77914 WP_000019311.1.78157 WP_000019311.1.78172 WP_000019311.1.78428 WP_000019311.1.78531 WP_000019311.1.78740 WP_000019311.1.79044 WP_000019311.1.79776 WP_000019311.1.79943 WP_000019311.1.80024 WP_000019311.1.8023 WP_000019311.1.80339 WP_000019311.1.80500 WP_000019311.1.80618 WP_000019311.1.80628 WP_000019311.1.80702 WP_000019311.1.80744 WP_000019311.1.80808 WP_000019311.1.8117 WP_000019311.1.81871 WP_000019311.1.81872 WP_000019311.1.81917 WP_000019311.1.82030 WP_000019311.1.82119 WP_000019311.1.82193 WP_000019311.1.82248 WP_000019311.1.82262 WP_000019311.1.82413 WP_000019311.1.82583 WP_000019311.1.83040 WP_000019311.1.83073 WP_000019311.1.83082 WP_000019311.1.83109 WP_000019311.1.83703 WP_000019311.1.83761 WP_000019311.1.84385 WP_000019311.1.84519 WP_000019311.1.84610 WP_000019311.1.8480 WP_000019311.1.85007 WP_000019311.1.85086 WP_000019311.1.85388 WP_000019311.1.85498 WP_000019311.1.85822 WP_000019311.1.85878 WP_000019311.1.85961 WP_000019311.1.85972 WP_000019311.1.85998 WP_000019311.1.86057 WP_000019311.1.86192 WP_000019311.1.86269 WP_000019311.1.86874 WP_000019311.1.86879 WP_000019311.1.87274 WP_000019311.1.87286 WP_000019311.1.87301 WP_000019311.1.87335 WP_000019311.1.87355 WP_000019311.1.87573 WP_000019311.1.87602 WP_000019311.1.87625 WP_000019311.1.87804 WP_000019311.1.88057 WP_000019311.1.88230 WP_000019311.1.88283 WP_000019311.1.88350 WP_000019311.1.88556 WP_000019311.1.8867 WP_000019311.1.89144 WP_000019311.1.89441 WP_000019311.1.89447 WP_000019311.1.89719 WP_000019311.1.89822 WP_000019311.1.89889 WP_000019311.1.8997 WP_000019311.1.89995 WP_000019311.1.90120 WP_000019311.1.90133 WP_000019311.1.90227 WP_000019311.1.90437 WP_000019311.1.90675 WP_000019311.1.90774 WP_000019311.1.90889 WP_000019311.1.91247 WP_000019311.1.91262 WP_000019311.1.91274 WP_000019311.1.91539 WP_000019311.1.91747 WP_000019311.1.91794 WP_000019311.1.91841 WP_000019311.1.92022 WP_000019311.1.92038 WP_000019311.1.92063 WP_000019311.1.92069 WP_000019311.1.92157 WP_000019311.1.92401 WP_000019311.1.92516 WP_000019311.1.92559 WP_000019311.1.92632 WP_000019311.1.92696 WP_000019311.1.92703 WP_000019311.1.92952 WP_000019311.1.92993 WP_000019311.1.9302 WP_000019311.1.93060 WP_000019311.1.93399 WP_000019311.1.93836 WP_000019311.1.93945 WP_000019311.1.94255 WP_000019311.1.94426 WP_000019311.1.94441 WP_000019311.1.94481 WP_000019311.1.94774 WP_000019311.1.94887 WP_000019311.1.95516 WP_000019311.1.95549 WP_000019311.1.9561 WP_000019311.1.95662 WP_000019311.1.95733 WP_000019311.1.95976 WP_000019311.1.96001 WP_000019311.1.9607 WP_000019311.1.96089 WP_000019311.1.96187 WP_000019311.1.96311 WP_000019311.1.96471 WP_000019311.1.9660 WP_000019311.1.96687 WP_000019311.1.96693 WP_000019311.1.96704 WP_000019311.1.96980 WP_000019311.1.97100 WP_000019311.1.97144 WP_000019311.1.97288 WP_000019311.1.97516 WP_000019311.1.97552 WP_000019311.1.97562 WP_000019311.1.97650 WP_000019311.1.97799 WP_000019311.1.97832 WP_000019311.1.9787 WP_000019311.1.98021 WP_000019311.1.98116 WP_000019311.1.98172 WP_000019311.1.98246 WP_000019311.1.98280 WP_000019311.1.98373 WP_000019311.1.98624 WP_000019311.1.98642 WP_000019311.1.99128 WP_000019311.1.99204 WP_000019311.1.99417 WP_000019311.1.99452 WP_000019311.1.995 WP_000019311.1.99861 WP_000019311.1.99872 WP_000019311.1.99992 gi|229606933|ref|YP_002877581.1| gi|15642512|ref|NP_232145.1| APC26804 gi|227082635|ref|YP_002811186.1| gi|384425450|ref|YP_005634808.1| gi|360036387|ref|YP_004938150.1| gi|147675756|ref|YP_001218014.1| gi|379742300|ref|YP_005334269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]