SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC28071 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC28071
Domain Number 1 Region: 32-123
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000314
Family Anti-sigma factor antagonist SpoIIaa 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC28071
Sequence length 129
Comment $ MCSG $ SQ21764 $ PDBT67518 $
Sequence
MGNAAAYQRYRRPDCATEIDFSTENHSGREKIMSESLSWMQTGDTLALSGELDQDVLLPL
WEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLY
NLPADVLPR
Download sequence
Identical sequences A0A0F6MHY7 A0A1X3JCD4 A0A1X3KYY9 D2A8B3 F4NHS9 F4SNR8 F4VJJ4 Q0T093 Q32BE2 Q3YX50 Q9EUP3
gi|82778505|ref|YP_404854.1| gi|30064529|ref|NP_838700.1| gi|74313728|ref|YP_312147.1| gi|384544787|ref|YP_005728851.1| gi|110807057|ref|YP_690577.1| APC28071 198214.SF3231 198215.S3449 300267.SDY_3372 300269.SSON_3339 373384.SFV_3221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]